KEGG   Miniopterus natalensis: 107536153
Entry
107536153         CDS       T05883                                 

Gene name
DUOX1
Definition
(RefSeq) dual oxidase 1
  KO
K13411  dual oxidase [EC:1.6.3.1 1.11.1.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107536153 (DUOX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536153 (DUOX1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.1  NAD(P)H oxidase (H2O2-forming)
     107536153 (DUOX1)
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     107536153 (DUOX1)
Membrane trafficking [BR:mna04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    107536153 (DUOX1)
SSDB
Motif
Pfam: An_peroxidase NAD_binding_6 Ferric_reduct FAD_binding_8 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 NAD_binding_1
Other DBs
NCBI-GeneID: 107536153
NCBI-ProteinID: XP_016067269
LinkDB
Position
Unknown
AA seq 1508 aa
MDFHLALAWTLLVGPWMPTGAQNPISWEVQRFDGWYNNLMEHRWGSKGYRLQRLVPATYA
DGVYQPLGEPYLPNPRDLSNTAMRGPAGQASLQNRTVLGVFFGYHVLSDLVSVERPGCPA
EFLNIRIPPGDPVFDPQRRGDVVLPFQRSRWDPKTGQSPSNPRDLVRLGGLRGRGGVRGS
XDAAFGAERGNREPFLQALGLLWFRYHNLWAQRLAREHPHWGDEELFQHARKRVIATYQN
IALYEWLPSFLQKTPPEYTGYRPFLDPSISPEFLVASEQFFSTMVPPGVYMRNASCHFQR
IINWDSSVSRALRVCNSYWSREHPNLQRAEDVDALLLGMASQIAEREDHVVVEDVRDFWP
GPLKFSRTDHLASSLQRGRDLGLPSYTKARAALGLPPITRWQDINPALFQSDGRVLEATA
ALYNQDLSLLELLPGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSGEEI
AEIRNTSLWDVLMAVTNVDPSALQPNVFFWHAGDPCPQPRQLSTEGLPACVPPVMRDYFK
GSGFGFGVTIGTLCCFPLVSLLVAWIVARLRRRNFKRLQGQNCQSIRSEKFVEGVEALEW
QGHKEPCRPVLVHLQPGQVRVMDGRLSVLRIIQLRPLQQVNLILSSNRGRHTLLLKIPKE
YDLVLLFNLEEERRALVENLRVALKESGLRFQEWELREQELMRAAVTREQRSHILETFFR
HLFSQVLDIDQADAGTLPLDSSQKVQEALTCELSRAEFANSLGLKPQDMFVESMFSLADK
DGNGYLSFREFLDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNN
CLSKAQLAEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGVEVPEVIKD
LCRRASYVSQDKLCPSPRVSARCSGSDVEVELTPQRLQCPMDTDPPQEIRRRFGKKVTLF
QPLLFTEAHRQKFQRSRRHQTVQQFKRFIENYRRHIGCVAVFYAWRALSSALLLPYPPGP
SADYAFASPPSGIAQTTYVGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVP
FDAAVDFHRLIASTAIVLTVLHSAGHVVNVYLFSISPLSILSCLFPGLFHDDGSEFPQKY
YWWFFQTVPGLTGVIMLLVLAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLIIIHGSFG
LIQLPRFHIFFLVPALIYGGDKLVSLSRKKVEISVVKAELLPSGVTHLQFQRPQGFEYKS
GQWVRIACLALGTTEYHPFTLTSAPHEDTLSLHIRAAGPWTTRLREIYSPPTDGCARYPK
LYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILKDLVFKSSVSYQVFCKKIYFIWVT
RTQRQFEWLADIIREVEENDHQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSL
FTGLRSVTHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTH
FSHHYENF
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggacttccacctggctctggcatggacactcctggttggtccatggatgcccacggga
gctcagaaccccatttcgtgggaggtgcagcgatttgatgggtggtacaacaaccttatg
gagcacagatggggcagcaaaggctatcggctgcagcgcctggtcccagccacctatgca
gatggtgtgtaccagcccttgggagaaccctacctgcccaatccccgagatctcagcaac
actgccatgaggggccctgcagggcaggcctccctgcaaaaccgcacagtgcttggggtc
ttctttggctaccacgtgctctcggacctggtcagcgtggagagacctggctgccccgcc
gagttcctcaacatccgcatcccgcccggggaccccgtgttcgacccccaacggcgcggg
gacgtggtgctgcccttccagaggagccgctgggaccccaagaccggacagagccccagc
aacccccgggacctggtgagactaggcggactgcggggcaggggcggggtccgagggagc
ncggacgcagccttcggggcagagcgagggaaccgcgagcccttcctgcaggcgctgggc
ctgctctggttccgctaccacaacctgtgggcgcagcggctggcccgcgagcacccgcac
tggggcgacgaggagctgttccagcacgcgcgcaagagggtcatcgccacttaccagaac
attgctctgtatgagtggctgcccagcttcttgcagaaaacacccccagaatatacaggg
taccgccctttcctggaccccagcatctctccagagttcctggtggcctctgagcagttc
ttttccaccatggtaccccctggcgtctacatgagaaatgccagctgccacttccagagg
atcatcaattgggattcaagtgtctccagagctctccgggtgtgcaacagctactggagc
cgagagcacccaaacctacaaagagctgaagatgtggatgcgctgctactgggcatggcc
tcccagattgctgagcgagaggaccacgtggtggttgaggatgtgcgagatttctggccc
gggccactgaagttttcccgcacagaccacttggccagcagcctgcagcggggccgggac
ctgggcctgccttcttacaccaaggccagggcagcactgggcctgcctcccattaccaga
tggcaggacatcaaccctgcactcttccagagtgatggcagggtgctggaagccacagct
gctctgtacaaccaggacctgtccctgctggagctgctccctggggggcttctggaaagc
catggggaccccggacccctcttcagcgccatagtccttgaccagtttgtgaggctgcgg
gatggtgaccgttactggtttgagaacaccaggaatgggctattctctggggaagagatt
gcagagatcagaaacacatccctatgggatgttctcatggctgtcaccaatgtggacccc
agtgccctgcagcccaatgtctttttttggcatgctggggacccctgcccacagccaaga
caactcagcaccgagggcctgccagcctgtgtcccccctgtcatgcgggactatttcaaa
ggcagtggatttggcttcggggtcaccatcgggaccctctgctgcttccccctggtgagc
ctgcttgttgcctggattgttgcccggctccgaaggagaaatttcaagaggctccagggc
cagaattgccagagcatcaggtctgagaagttcgtggagggtgtggaagcgttggaatgg
cagggccacaaggagccctgccggcctgtgcttgtgcacctgcagcctgggcaggtccgt
gtcatggatggcaggctctctgtgctccgcatcatccagctgaggcccctgcagcaggtc
aacctcatcctgtccagcaaccgtggacgccacaccctgttgctcaagattcccaaggag
tatgacctggtgctgctgtttaacctggaggaagagcggcgggcactggtggaaaacctt
cgggtggctctgaaggagagtgggctgagattccaggagtgggagctgcgggagcaggag
ctgatgagggcagcggtgacgcgggagcagcggagccacatcctggagacctttttcagg
caccttttctcccaggtgctagacatcgaccaggcggacgcagggaccctgcccctggac
tcatcacagaaggtgcaggaggccctgacatgcgagctcagcagggctgagtttgccaac
tctctgggcctcaagccccaggacatgtttgtggagtccatgttctctctggccgacaaa
gatggcaatggctacctgtccttccgggagttcctggacatcctggtggtcttcatgaaa
ggctcccctgaggagaagtctcgccttatgttccgcatgtacgactttgatgggaatggt
ctcatttccaaggatgagttcatcaggatgctgaggtccttcatcgagatctccaacaac
tgcctgtccaaggcccagctggccgaggtggtggagtccatgttccgggagtcaggcttc
caggacaaggaggagctgacgtgggaggacttccacttcatgctgcgggaccacgacagc
gagctccgcttcacacagctctgtgtcaaaggggtggaagtgcctgaagtcatcaaggac
ctctgccggagagcctcctacgtcagccaggataagctctgtccctctcccagagtgagt
gctcgctgttcgggcagtgatgtcgaggtggagctgacaccacagagactgcaatgcccc
atggacacagatcctccccaggagattcgacggaggtttggcaagaaggtcacgttgttt
cagcccctgctgttcaccgaggctcaccgacaaaagtttcaacggagccgtcgtcaccag
accgtgcagcagttcaagcgcttcatcgagaactaccggcgccacatcggctgcgtggcc
gtgttctacgcctggcgcgctctctcctctgcactgctcctcccttacccacccggcccc
tccgcagactacgcctttgcctcgccaccctcgggcattgcccagaccacctatgtgggc
atcatcctgtcgcggggcacggccgccagcatctccttcatgttctcctacatcctgctc
accatgtgccgcaacctcatcaccttcctgcgcgagaccttcctcaaccgctacgtgccc
ttcgacgcggccgtggacttccatcgcctcattgcctccactgccatcgtgctcacagtc
ttacacagtgcaggccatgtggtgaacgtgtacctgttctccatcagcccgctcagcatc
ctgtcctgcctcttccctggcctcttccatgatgatgggtccgagtttccccagaagtat
tactggtggttcttccagactgtgccaggcctcacgggggtcataatgctcctggtcctg
gccatcatgtatgtcttcgcctcccaccacttccggcgccgcagcttccggggcttctgg
ctgacccaccacctctacatcctgctctacgtcctgatcatcatccacggcagcttcggc
ctgatccagctgccccgtttccacatcttcttcctggtcccggcactaatctatggcggg
gacaagctggtgagcctgagcaggaagaaggtggagatcagcgtggtgaaggcagagctg
ctgccctcaggagtgacccacctgcagtttcagcggccccaaggctttgagtacaagtca
ggacagtgggtgcggattgcttgcctggctctgggcaccaccgagtaccaccccttcaca
ctgacttctgcgccccatgaggacactctcagtctgcacatccgggcggccgggccctgg
accactcgcctcagagagatttattcacccccgactgatggctgtgccagatacccgaag
ctgtaccttgatggaccatttggagagggccaccaggagtggcataagtttgaggtgtca
gtgctggtaggagggggcattggggtcaccccctttgcctccatccttaaagacctggtc
ttcaagtcatcagtcagctaccaagtgttctgcaagaagatctacttcatctgggtgaca
cggacccagcggcagttcgagtggctggctgacatcatccgggaggtggaggagaatgac
caccaggacctggtgtccgtgcacatctacatcacccagctggctgagaagttcgacctc
aggaccaccatgctgtacatctgcgagcgtcacttccagaaggtgctgaaccggagtctg
ttcacaggcctgcgctctgtcacccactttggtcgcccccccttcgagcccttctttaac
tccctgcaggaggttcacccacaggtccggaagattggggtgtttagttgtggccctccc
ggcatgacaaagaatgtagaaaaggcctgtcagctcatcaacaggcaggaccggactcat
ttctcccaccattacgagaacttctag

KEGG   Miniopterus natalensis: 107536249
Entry
107536249         CDS       T05883                                 

Gene name
DUOX2
Definition
(RefSeq) dual oxidase 2
  KO
K13411  dual oxidase [EC:1.6.3.1 1.11.1.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107536249 (DUOX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536249 (DUOX2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.1  NAD(P)H oxidase (H2O2-forming)
     107536249 (DUOX2)
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     107536249 (DUOX2)
Membrane trafficking [BR:mna04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    107536249 (DUOX2)
SSDB
Motif
Pfam: An_peroxidase NAD_binding_6 Ferric_reduct FAD_binding_8 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 NAD_binding_1 PepSY_TM
Other DBs
NCBI-GeneID: 107536249
NCBI-ProteinID: XP_016067393
LinkDB
Position
Unknown
AA seq 1547 aa
MLGARPEAVVFLGALLTGSLIPAGGQDTLPLSWEVQRYDGWFNNLRHHERGAAGCRLQRL
VPANYADGVYQALGEPLLPNPRQLSLAATRGSPGLASRRNRTVLGVFFGYHVLSDLVSVE
RPGCPAEFLNIRIPPGDPVFDPQRRGDVVLPFQRSRWDPKTGQSPSNPRDLTNEVTGWLD
GSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDTQVPLLMWTAPDPATEQRGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLAREHPHWGDEELFQHARKRVIATYQNIALYE
WLPSFLQKTPPEYTGYRPFLDPSISPEFLVASEQFFSTMVPPGVYMRNASCYFQKITIKD
FGSSPALRVCNSYWIRENPYLNSAQAVNHLLLGMASQISELEDRIVVEDLRDYWPGSGKF
TRTDYVASSIQRGRDMGLPSYSQALLALGLEIPKNWSHLNPDVDPQVLEATAALYNQDLS
LLELLPGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSREEIAEIRNTTL
RDVLVAVTNVDPSTLQPNVFIWHEGAPCPQPQQITTVGLPSCVHMTVFDYFKGSGPGFGI
TIVALCCLPLVSLLISGVVAHFRSRERKKLQKKNKESMKKEAAKVGVPAMEWPGPREGSY
PITIQLLPDRCLQILDGHLSVLRTIQLQPLQQVNLILSSNRRRRTLLLKIPKEYDLVLLF
NSEEERNTFVQQLRDFCVRWNLSLPTAEMGENELFRKAVTKQQRGRILEIFFRHLFAQVL
DINQADAGAMPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVEYMFSLADKDGNGYLS
FREFLDILVVFMKGSPEDKSRLMFNMYDLDGNGFLSKEEFFTMMRSFIEISNNCLSKAQL
AEVVESMFRESGFQNKEELTWEDFHFMLRDHDSELRRTQLCIKGGGGCGGAGVEDIFKPQ
INCRVSFIARTPGERSSQGVGVPALEAPELGGPVLKKRFGKKVVVTPPRLYTEALQEKMR
RGLLAQKLRQYKRFVENYRRHIVCIAVFSAICAGLFAERAYFYAFASPSSGIAQTTYVGI
ILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVILAIL
HSAGHAVNVYIFSVSPLSLLACIFPSVFVNDGSQFPQKFYWWFFQTVPGMTGVLLLLVLA
IMYVFASHHFRRRSFRGFWLTHHLYILLYVLIIIHGSFGLIQLPRFHIYFLVPALIYGGD
KLVSLSRKKVEISVVKAELLPSGVTHLQFQRPQGFEYKSGQWVRIACLALGTNEYHPFTL
TSAPHEDTLSLHIRAAGPWTIRLREIYSPPADSCAKYPKLYLDGPFGEGHQEWHKFEVSV
LVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIREVEENDH
QDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSVTHFGRPPFEPFFNS
LQEVHPKVRKFGVFSCGPPGMTKNVEKACQLINRQDQALFMHHYENF
NT seq 4644 nt   +upstreamnt  +downstreamnt
atgctcggcgcaagaccagaggcagtggtgttcctgggagctctactgactgggtcgcta
attccagcaggcggccaggacacactcccactgtcctgggaagtgcagcgctatgacggc
tggttcaacaacctgaggcaccacgagcgcggcgctgcaggctgccgattgcaacgccta
gtaccagccaattacgcggacggcgtgtatcaagctctgggagagccgctgctgcccaac
ccgcgccagctcagcctcgctgccacgcggggcagcccgggactggcatcccgccgcaac
cgcacggtgctgggggtcttctttggctaccacgtgctctcggacctggtcagcgtggag
agacctggctgccccgccgagttcctcaacatccgcatcccgcccggggaccccgtgttc
gacccccaacggcgcggggacgtggtgctgcccttccagaggagccgctgggaccccaag
accggacagagccccagcaacccccgggacctgaccaacgaggtgaccggctggctggac
ggcagcgccatctatggctcctctcactcctggagcgacgcactgcggagcttctcgggg
ggacagctggcgtccgggcccgaccccgccttcccccgggacacgcaggtccccctgctc
atgtggaccgcgcccgaccccgccacggaacagcgcgggccgcgggggctgtacgccttc
ggggcagagcgagggaaccgcgagcccttcctgcaggcgctgggcctgctctggttccgc
taccacaacctgtgggcgcagcggctggcccgcgagcacccgcactggggcgacgaggag
ctgttccagcacgcgcgcaagagggtcatcgccacttaccagaacattgctctgtatgag
tggctgcccagcttcttgcagaaaacacccccagaatatacagggtaccgccctttcctg
gaccccagcatctctccagagttcctggtggcctctgagcagttcttttccaccatggta
ccccctggcgtctacatgagaaatgccagctgttattttcagaagatcacaatcaaggat
tttggcagctccccagccctcagagtctgcaacagctactggattcgggagaacccctac
ctgaacagcgcccaagcagtgaatcatctgctgctgggaatggcctcccagatttcagag
ctggaggacaggatagtggttgaagatctgagggattattggcctggttctggcaagttc
acccgcacagactacgtggccagcagcatccaacgtggccgggatatggggctgcccagc
tatagccaagctcttctagccttggggttagagatcccgaagaactggagtcacctcaac
cccgatgtggacccccaggtgctggaggccacagctgccctgtacaaccaggacctgtcc
ctgctggagctactccctggggggcttctggagagtcacggggaccctggacctctcttc
agcgccatagtccttgaccagtttgtgaggctgcgggatggtgaccgttactggtttgag
aacaccaggaatgggctgttctccagggaggaaattgcagaaatcagaaacaccactctg
cgggatgtgctggtggctgtcaccaatgtggaccccagtaccctgcagcctaatgtcttt
atctggcatgaaggtgcaccatgcccgcagccccagcagatcacaactgttggtttgcca
tcctgtgtgcacatgaccgtgtttgactactttaagggcagtggtcctggttttggtatc
accattgtggctctctgctgtcttccactagtgagtctgcttatctctggggtggtggcc
catttccggagccgagaacgcaagaagttacaaaagaaaaacaaagagagtatgaagaag
gaggcagccaaagtcggagttccagcaatggagtggccaggccctagagaggggagctac
cccatcaccattcagctgctgccagacaggtgtctccagattctggatgggcatctctct
gtgctccgcaccatccagctgcagcccctgcagcaggtcaacctcattctgtccagcaac
cgcagacgtcgcaccctgctgctcaagatccccaaggagtatgacctggtgctgctgttt
aactctgaggaggagcgaaacacttttgtgcagcagctgcgagacttctgtgtgcgctgg
aatctcagcctccccacagctgagatgggcgagaatgagctgttcaggaaggctgtgacc
aagcagcagcggggacgcatcctggagatcttcttcaggcacctttttgcccaggtgctg
gacatcaaccaggcagatgcaggagccatgcccctggactcatcacagaaggtgcgagag
gccctgacgtgtgagctgagtagggctgagtttgctgagtcccttggcctcaagccccag
gacatgtttgtggagtacatgttctctctggctgacaaagatggcaatggctacctgtcc
ttccgggagttcctggacatccttgtggtctttatgaaaggctccccagaggacaagtcc
cgcttgatgttcaacatgtacgaccttgatggaaatggctttctctccaaggaggaattc
ttcaccatgatgcggtccttcatcgagatctccaacaactgcctgtccaaggcccagttg
gccgaggtggtggagtccatgttccgggagtcaggcttccagaacaaggaggagttgaca
tgggaggacttccactttatgttgagggaccatgacagtgagcttcgtcgcacgcagctc
tgcatcaaaggtggaggtggctgcgggggggcaggtgttgaagacatctttaaaccacaa
atcaactgtcgagtctcattcattgctcggactcctggggaacgctcctcccaaggggtg
ggggttcctgccttagaagccccagagctgggaggccctgtgctgaagaagaggtttggc
aaaaaggtagtggtgacccctccccggctgtacacggaggcgctgcaggagaagatgcgt
cggggcctcttggcgcagaagctgcggcagtacaagcgcttcgtggagaactaccggcgc
cacatcgtgtgcatcgcggtcttctcggccatctgtgcaggcctgtttgcagagcgtgct
tacttctatgcctttgcctcgccatcctcgggcattgcccagaccacctatgtgggcatc
atcctgtcgcggggcacggccgccagcatctccttcatgttctcctacatcctgctcacc
atgtgccgcaacctcatcaccttcctgcgcgagaccttcctcaaccgctacgtgcccttc
gacgcggccgtggacttccatcgctggatcgccatggctgctgttatcctggctattctg
cacagtgctggccacgcggtcaatgtctacatcttctcagtcagtcccctcagcctgctg
gcctgcatcttccccagcgtctttgtgaatgatgggtcgcagtttccccagaagttctac
tggtggttctttcagacagtcccaggtatgacaggggtgcttctgctcctggtcctggcc
atcatgtacgtcttcgcctcccaccacttccggcgccgcagcttccggggcttctggctg
acccaccacctctacatcctgctctacgtcctgatcatcatccacggcagcttcggcctg
atccagctgccccgtttccacatctacttcctggtcccggcactaatctatggcggggac
aagctggtgagcctgagccggaagaaggtggagatcagcgtggtgaaggcggagctgctg
ccctcaggagtaactcacctgcagttccaacgaccccaaggctttgagtacaagtcagga
cagtgggtgcggatcgcctgcctggctctgggcaccaacgagtaccaccccttcacactg
acttccgcgccccatgaggacacgctcagtctgcacatccgggcggccgggccctggacc
attcgcctcagggagatctactcacccccagctgacagctgtgccaaatacccgaagctg
tacctcgatggaccatttggagagggccaccaggagtggcataagtttgaggtgtcagtg
ctggtgggaggaggcattggggtcaccccctttgcttctatcctcaaagacctggtcttc
aagtcatccttgggcagccaaatgctctgtaaaaagatctacttcatctgggtgacacgg
acccagcggcagttcgagtggctggctgacatcatccgggaggtggaggagaatgaccac
caggacctggtgtctgtgcacatctacatcacccagctggctgagaagttcgacctcagg
accaccatgctgtacatctgcgagcggcacttccagaaggtgctgaacaggagtctgttc
acaggcctgcgctctgtcacccactttggtcgcccccctttcgagcccttctttaactcc
ctgcaggaggttcacccaaaggtacgaaagtttggagtattcagctgcggccctccagga
atgaccaagaatgtagagaaggcctgtcagctcatcaacaggcaggaccaggccctcttc
atgcaccactacgagaacttctga

DBGET integrated database retrieval system