KEGG   Miniopterus natalensis: 107536164
Entry
107536164         CDS       T05883                                 

Gene name
DUOXA2
Definition
(RefSeq) dual oxidase maturation factor 2
  KO
K17232  dual oxidase maturation factor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107536164 (DUOXA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536164 (DUOXA2)
Membrane trafficking [BR:mna04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107536164 (DUOXA2)
SSDB
Motif
Pfam: DuoxA
Other DBs
NCBI-GeneID: 107536164
NCBI-ProteinID: XP_016067281
LinkDB
Position
Unknown
AA seq 320 aa
MTLWDGELPFYPQSRRAAGFSVPLLIVIVVFLSLAASFLLILPGIRGHSRWFWLVRVLLS
LFIGTEIVAVNFSAEWSVGSVNTNTSYKAFSAARVGAYVGLHVGLEGVNITLTGTPVQQL
NETIDYNEQFTWRLGEDYAEEYREALERGLPDPVLYLAEKFTPSSPCGLYRQYRMAGHYA
SAMLWVAFCLWLLSNVLLSMPVPLYGGLALLATGAFALFSVLAFVSISSAPLCPLHLGSS
ALTSHYGAAFWVTLATGVLCLLLGGAVVGLHYARPRALRTFLDRSDKNCGNQARGDSPLN
LNHPLYKQFGVSESTISTKL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgactctctgggacggcgagctgcctttctacccccagtcccggcgagccgcgggcttc
agcgtcccgctgctcatcgtcattgtggtgttcttgtcgctggctgccagcttcttgctc
atcttgcctgggatccgtggccactcgcgctggttctggttggtgagagttctcctcagt
ctgttcataggcacagaaatcgtggcggtgaacttcagcgcagaatggtcagtgggtagc
gtgaacaccaacacctcctacaaggccttcagcgcagcccgtgtcggagcctacgtaggt
ctgcacgtgggcctggagggagttaatattacactcacagggaccccagtgcagcagctg
aacgagactatcgactacaacgagcagttcacgtggcgtctgggcgaggactacgcggag
gagtacagggaggcgctggagagggggctgccggatccagtcctctacttggcggagaag
ttcacgccgagcagcccttgcggactctaccgccagtaccgcatggcggggcactacgct
tcagccatgctgtgggtggcgttctgcctctggctcctctccaacgtgctgctctccatg
ccggtcccgctctacgggggcctggcgctcctggccaccggcgccttcgcgctcttctct
gtgctggccttcgtctccatctccagcgcgccgctctgcccgctccacctcggctcctcc
gcgctcaccagtcactacggcgccgccttttgggtcacgctggccacaggcgtcctgtgc
ctccttctgggaggggcggtggtgggtctccactacgctcggcccagggcccttcgcacc
ttcttggaccgaagcgacaagaactgcggtaaccaagcgagaggggactcgcctctcaac
ctcaaccacccactatacaagcagttcggggtctcggaatcaacgatcagcactaaactg
tga

DBGET integrated database retrieval system