KEGG   Miniopterus natalensis: 107536251
Entry
107536251         CDS       T05883                                 

Gene name
SLC8A3
Definition
(RefSeq) sodium/calcium exchanger 3 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04740  Olfactory transduction
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04974  Protein digestion and absorption
mna04978  Mineral absorption
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107536251 (SLC8A3)
   04020 Calcium signaling pathway
    107536251 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    107536251 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107536251 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    107536251 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    107536251 (SLC8A3)
   04978 Mineral absorption
    107536251 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107536251 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    107536251 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107536251 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107536251 (SLC8A3)
   05414 Dilated cardiomyopathy
    107536251 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107536251 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107536251 (SLC8A3)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107536251 (SLC8A3)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Others
   107536251 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 107536251
NCBI-ProteinID: XP_016067391
LinkDB
Position
Unknown
AA seq 927 aa
MAWLRLQPLTSAFLHFGLITFVLFLNGLRAEAGGSGDVPGTGKNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTVRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLIF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRKEVIRILKDLKQKHPEKDLDQLVEMANYYALSHQPKSRAFYRIQAIR
MMTGAGNILRKHAAERAKRSANTRDVHTQEPEDFVSKVFFDPCSYQCLENCGAVLLTVVR
KGGDTSKTVYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNARTEEWQPEEGVPPTVLSSPPRPRAVLVSPYVATVTILDDDHAGIFAFECDSIH
VSESVGVMEVKVLRTSGARGTVVVPFRTVEGTAKGGGEDFEDIYGELEFKNNETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISALLLSSEMTDRKLTVEEEEARRIAEMGKPVL
GKHPKLEVIIEESYEFKSTVDKLIKKTNMALVVGTHSWKDQFMEAITVSAAGDEEEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTGYWNGWACFSVSILIISVLTAVIGDLASHFG
CTIGLKDSVTAVIFVAFGTSVPDMFASKAAATQDVYADASVGNVTGSNAVNVFLGIGLAW
SVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLA
TTWLLVSLWLLYILFSTLEAYCYIKGF
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggcgtggttaaggttgcagcctctcacctctgccttcctccattttgggctgattact
tttgtgctcttcctgaatggtcttcgggcagaggctggtggctcaggggatgtgcccggc
acagggaagaacaatgagtcctgttcagggtcatcggactgcaaggagggtgtcatctta
ccaatctggtacccggagaacccttctcttggggataagattgccagggtcatcgtctat
tttgtggccctgatatacatgttccttggggtatccatcattgctgaccgcttcatggca
tctattgaagtcatcacttctcaagagagagaggtgactatcaaaaagcccaatggagag
accagcacaacaacggttcgggtatggaacgaaactgtctccaacctgacccttatggcc
ctgggttcctctgctcctgagatcctcctctctttaattgaggtatgtggtcatgggttc
attgctggtgatctgggaccttctaccattgtgggcagtgcagccttcaacatgttcatc
atcattggcatctgcgtctacgtgatccccgatggagagactcgtaagatcaagcaccta
cgagtcttctttgtcactgctgcttggagcatctttgcctacatctggctctatatgatc
ctggcggtcttttctcctggtgtggtccaggtttgggaaggcctcctcactctcatcttt
tttccagtgtgtgtccttctggcctgggtggcagataaacgactgctcttctacaaatac
atgcacaaaaagtaccgcacagataaacaccgaggaattatcatagagacagagggtgac
caccccaagggcattgagatggatgggaaaatgatgaattcccactttctagatgggaat
ttggtgcccctggaagggaaggaagtggatgagtcccgcaaggaggtgatccggatcctc
aaggatctgaagcaaaaacatccagagaaggacctagatcagctggtagagatggccaat
tactatgctctttcccatcaaccgaagagccgcgccttctaccggattcaagccatccgt
atgatgactggcgcaggcaacatcctgaggaaacatgctgcagaacgagccaagaggtct
gccaacacgagggacgtgcacacccaggagcccgaggactttgtctccaaggtcttcttt
gacccgtgctcttaccagtgcctggagaactgtggggctgtgctcctgacggtggtgagg
aaagggggggacacgtccaagaccgtgtatgtggactacaaaacagaggatggttctgcc
aacgcgggggctgactatgagttcacagagggcactgtggttctgaagccaggagagacc
cagaaggagttctctgtgggcatcattgatgacgacatctttgaggaagacgaacacttc
ttcgtgaggttgagcaatgcccgcacggaggagtggcagccggaggagggggtgccgcca
acagtgctgagcagccctccccggcctcgggctgtcctggtgtccccttatgtggccacg
gtcactatcttggatgatgaccatgcaggcatcttcgcttttgaatgcgacagtattcat
gtcagtgagagtgttggtgtcatggaggtcaaggttctgcggacatcaggtgcccggggc
acagtcgtcgtcccctttaggacagtagaagggacagccaagggtggtggtgaggatttt
gaagacatatatggggagttggagttcaagaacaatgaaactgtgaaaaccataagggtt
aaaatagtagatgaggaggaatacgaaaggcaagagaatttcttcattgcccttggtgag
ccgaaatggatggaacgtggaatatcagcgctcctgttgtcttcagagatgacagacagg
aagctgactgtggaggaagaggaggccaggaggatagcagaaatgggaaagccagtattg
ggtaaacaccccaaactagaggtcatcattgaagagtcctatgagttcaagagtactgtg
gacaaactgatcaagaagacaaatatggctttggtcgtggggacccactcctggaaggac
cagttcatggaggccatcaccgtcagtgcagctggggacgaggaggaggatgagtcgggc
gaggagaggctgccgtcctgcttcgactacgtcatgcacttcctgactgtcttctggaag
gtgctgttcgcctgcgtgccccccacggggtactggaatggctgggcctgcttctccgtc
tccatcctcatcatcagcgtcctcacggccgtcatcggggacctagcctcccacttcggc
tgcacgattggcctcaaggactcagtcacggccgtcattttcgtggcgtttggcacctct
gtgccagatatgtttgccagcaaagctgccgccacccaggacgtgtacgcagacgcctcc
gtcggcaacgtcacgggcagcaacgccgtcaacgtcttcctgggcattggcctggcctgg
tccgtggccgccatctactgggccatgcagggacaggagttccacgtgtccgccggcacg
ctggccttctccgtcaccctcttcaccatcttcgcgttcgtctgcatcagcgtgctcctg
taccgcaggcggccccacctgggcggggagctgggcggcccccgcggctgcaagcttgcc
accacttggctcttggtgagcctgtggctcctctacatactcttttccacgctggaggcc
tactgctacatcaaggggttctga

KEGG   Miniopterus natalensis: 107540036
Entry
107540036         CDS       T05883                                 

Gene name
SLC8A2
Definition
(RefSeq) sodium/calcium exchanger 2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04740  Olfactory transduction
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04974  Protein digestion and absorption
mna04978  Mineral absorption
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107540036 (SLC8A2)
   04020 Calcium signaling pathway
    107540036 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    107540036 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107540036 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    107540036 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    107540036 (SLC8A2)
   04978 Mineral absorption
    107540036 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107540036 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    107540036 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107540036 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107540036 (SLC8A2)
   05414 Dilated cardiomyopathy
    107540036 (SLC8A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107540036 (SLC8A2)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107540036 (SLC8A2)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107540036 (SLC8A2)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Others
   107540036 (SLC8A2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex
Other DBs
NCBI-GeneID: 107540036
NCBI-ProteinID: XP_016072197
LinkDB
Position
Unknown
AA seq 839 aa
MAPLALVGFALLLGAPPCSGAATPTPSLPPPPTNDSDTSTEVCQGSNRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
VYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVSKDPWIPPWCMCVC
KIHRGGSLGLESGSMYPRKCVLTPERAARYSCAGHALRQSFGLERAVRRHAADASRRASP
AEGPCEDVDDGASRIFFEPSLYHCLENCGSVLLSVACRGGEGNSTFYVDYRTEDGSAKAG
SDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRVGDAQGMFEPDGGGR
PKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYRT
VDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGI
SALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLEVIIEESYDFKNTVDKLIKKTN
LALVIGTHSWREQFLEAITVSAAGEEEEDGSREERLPSCFDYVMHFLTVFWKVLFACVPP
TEYCHGWACFGVCILVIGLLTALIGDLASHFGCTVGLKDSVNAVVFVALGTSIPDTFASK
VAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVYWAVQGRPFEVRTGTLAFSVTLF
TVFAFVGIAVLLYRRRPHIGGELGGPRGPKIATTALFLGLWLLYILFASLEAYCHIRGF
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggctcccctggccttggtgggatttgctctcctcctgggggctcccccatgctccggg
gcagctaccccgaccccctctctgccacctccccccaccaatgacagcgataccagcacg
gaggtctgccagggttccaaccgctgccagccaggggtcctgctgcccgtctgggagccc
gatgacccatcactgggtgacaaggcggcacgggcggtggtctactttgtggccatggtc
tacatgttcctgggcgtgtccatcatcgctgaccgcttcatggcgtccatcgaggtcatc
acgtccaaggagaaggagatcaccatcaccaaggccaacggtgagaccagcgtgggcacc
gtccgcatctggaacgagaccgtgtccaacctcacactcatggccctgggctcgtcggcg
cccgagatcctgctgtctgtcatcgaggtctgcggccacaacttccaggcgggagagctg
ggcccgggcaccatcgtgggcagtgctgccttcaacatgtttgtggtcattgccgtgtgt
gtctacgtcatcccggccggcgagagccgcaagatcaagcacctgagagtcttctttgtc
actgcctcttggagcatctttgcctacgtctggctctatctcatccttgccgtcttttcc
ccgggtgtggtccaggtgagcaaggacccatggatacctccttggtgcatgtgtgtctgc
aaaatccataggggtggctccctgggcttggagagtggatccatgtacccgcggaagtgc
gtgctcacacccgagagggccgccaggtacagctgtgcaggccacgcgctgcgccagagc
ttcgggctggagagggcagtgcggcgacacgcggcggacgcgtcgcgcagggcctccccg
gccgagggcccctgcgaggacgtggacgacggcgccagccgcatcttcttcgagcccagc
ctgtaccactgcctggagaactgcggctccgtgctgctctccgtcgcctgccggggcggc
gagggcaacagcaccttctacgtggactaccgcacggaggacggctcggccaaggcgggc
tccgactacgagtacagcgagggcaccctggtgttcaagccgggcgagacgcagaaggag
ctgcgcatcggcatcatcgacgacgacatctttgaggaggacgagcacttcttcgttcgg
ctgctgaacctgcgcgtgggcgacgcgcagggcatgttcgagcccgacggcggcgggcgg
cccaaagggcggctggtggcgccgctgctggccaccgtcaccatcctggacgacgaccac
gcgggcatcttctccttccaggaccgcctgctgcacgtgagcgagtgcatgggcaccgtg
gacgtgcgcgtggtgcgcagctcgggcgcgcgcggcaccgtgcgcctcccctaccgcacg
gtggacggcacggcgcgcggcggcggggtgcactacgaggacgcgtgcggcgagctcgag
ttcggcgacgacgagaccatgaaaactctccaggtgaagatagttgacgatgaagaatac
gagaaaaaggacaacttcttcattgagctgggccagccacagtggctgaagcgagggatc
tcagctctgctgctcaatcaaggggacggggacaggaagctgacggccgaggaggaggag
gcccggcggatagcagagatgggcaagccggttcttggggaaaactgccggctcgaggtc
atcatagaagagtcctacgactttaagaacacagtggacaagctcatcaagaaaacgaac
ttggctctggtgattggcacccactcgtggagggagcagtttttagaggcgattacggtg
agcgcagctggtgaggaggaggaggacgggtcccgggaggagcggctgccttcgtgcttt
gactacgtcatgcacttcctgacggtgttctggaaggtgctgttcgcctgcgtgcccccc
actgagtactgccacggctgggcttgcttcggtgtctgcatcctggtcattggcctgctc
accgccctcatcggggaccttgcctcccactttggctgcactgttggcctcaaggactcc
gtcaacgctgtggtcttcgtggccctgggcacctctatccccgacaccttcgccagcaag
gtggcggcgctgcaggaccagtgcgcggacgcgtccatcggcaacgtgaccggctccaac
gcggtgaacgtgttcctgggcctgggcgtggcctggtcggtggccgccgtgtactgggcg
gtgcagggccgccccttcgaggtgcgcaccggcacgctggccttctccgtcacgctcttc
accgtcttcgccttcgtgggcatcgccgtgctgctgtaccggcgccggccgcacatcggc
ggcgagctgggcggcccgcgcggccccaagatcgccaccaccgcgctcttcctgggcctc
tggctcctctacatcctgttcgccagcctggaggcctactgccacatccgcggcttctag

KEGG   Miniopterus natalensis: 107541794
Entry
107541794         CDS       T05883                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04740  Olfactory transduction
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04974  Protein digestion and absorption
mna04978  Mineral absorption
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107541794 (SLC8A1)
   04020 Calcium signaling pathway
    107541794 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    107541794 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107541794 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    107541794 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    107541794 (SLC8A1)
   04978 Mineral absorption
    107541794 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107541794 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    107541794 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107541794 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107541794 (SLC8A1)
   05414 Dilated cardiomyopathy
    107541794 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107541794 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107541794 (SLC8A1)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107541794 (SLC8A1)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Others
   107541794 (SLC8A1)
SSDB
Motif
Pfam: Na_Ca_ex Calx-beta Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 107541794
NCBI-ProteinID: XP_016074444
LinkDB
Position
Unknown
AA seq 964 aa
MLRVSLSPTFSLGFHLLAIMAVLFSHVDHISAEAEMEGEGNETGECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYLILSVISPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNPDMAENDPVSKIFFEQGTYQCLENCG
TVALTIVRRGGDLTNTVCVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVKVSPEASEDGILEANHVAALACLGSPCTATVTIFDDDHAGIFTFE
EPVTHVSESIGVMEVKVLRTSGARGNVIVPYKTLEGTARGGGEDFEDTCGELEFQNDEIV
KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMKALLLNELGGFTITGQPVFRKVHAREH
PIPSTVITIAEECDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKL
IKKTNLALVVGTNSWREQFIEAITVSAGEDDDEDECGEEKLPSCFDYVMHFLTVFWKVLF
AFVPPTEYWNGWACFIVSIIMIGVLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPD
TFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAF
SVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCH
IKGF
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgttgcgagtaagtctctcacccaccttttccctgggatttcatctgttggccatcatg
gctgtcttattttcccatgtggaccacataagtgctgaggcagagatggaaggagaaggc
aatgaaactggtgagtgtaccggctcatattactgtaagaaaggggtgattttacccatt
tgggagccccaagacccttcctttggggacaaaattgctagagctactgtgtattttgtg
gccatggtctacatgtttctcggagtctctatcattgccgaccggttcatgtcctccata
gaagtcatcacatctcaagagaaagaaataaccataaagaagcccaatggagagaccacc
aagacaaccgtgaggatctggaacgagacggtttccaacctgaccttaatggccctgggc
tcttctgcccccgagattctcctttcggtgatcgaagtgtgtggccataacttcactgcg
ggggacctgggccccagcaccatcgtgggaagcgccgccttcaacatgttcatcatcatc
gccctttgtgtctacgtggtgcccgatggagagaccaggaagatcaagcatctgcgcgtg
ttcttcgtgacggcggcctggagcatctttgcctacacctggctttaccttatcctgtcc
gtcatctcccccggggtcgtggaggtctgggaaggtctgctcactttcttcttcttcccc
atctgcgtcgtgtttgcctgggtggccgacaggaggcttctgttttacaagtatgtctac
aagaggtatcgggctggcaagcagagggggatgattattgaacacgagggggacaggccg
tcttccaagactgagatcgagatggatgggaaagtggtcaattcccacgttgacaacttc
ttagacggcgccctggttctggaggtcgatgagagggaccaggacgacgaagaggccagg
cgggaaatggccaggatcctgaaggagctcaagcagaagcacccagataaagaaatagag
cagttgatagaattagcgaactaccaggtcctcagtcagcagcagaaaagccgggccttc
taccgcattcaggccacccgcctgatgaccggagcgggcaacattctgaagcgacacgcg
gccgaccaggcgcgcaaggccgtcagcatgcacgaggtgaacccagacatggccgagaac
gacccggtcagcaagatcttcttcgaacaagggacctaccagtgcctggagaactgcggc
accgtggccctgaccattgtccgcagaggtggcgacctcaccaacaccgtgtgcgtcgac
ttcagaaccgaggacggcacggccaacgcgggctccgattatgaattcaccgaggggacc
gtggtcttcaagcccggcgagacccagaaggagatccgcgtgggcatcatcgacgacgac
atcttcgaggaggacgagaacttcctcgtgcacctcagcaacgtcaaggtgtcgcccgag
gcctcggaggacggcatcctggaggccaaccacgtggccgcgctcgcgtgcctcggctcg
ccctgcacggccaccgtgaccatcttcgacgacgaccacgcgggcatcttcacgttcgag
gagcccgtgactcacgtgagcgagagcatcggcgtcatggaggtgaaagtgttgagaacg
tctggagctcgaggaaacgtcatcgtcccctataagaccctcgagggcactgccagaggt
ggaggggaggacttcgaggacacctgcggggagctcgagttccagaacgatgagattgtg
aagatcattaccattagaatatttgaccgtgaggaatatgagaaagagtgcagtttctcc
cttgtgcttgaggaaccaaaatggataagaagaggaatgaaagccctgttattgaatgag
cttggtggcttcacaataacaggccaacctgtcttcaggaaagttcacgctagagaacat
ccgattccctctactgtaatcaccattgcagaggaatgtgacgacaagcagccgctgacc
agcaaagaagaggaggagaggcgcattgcagaaatggggcgccccatcctgggagaacac
accaagctggaagtgatcatcgaagaatcctatgaattcaagagcaccgtggacaaactt
attaagaagacaaacctagccctggtggttgggacaaacagctggagagagcagtttatt
gaagcgatcactgtcagtgctggagaagatgatgatgaagacgaatgtggggaggagaag
ctgccctcctgtttcgattacgtgatgcactttctgactgtgttctggaaggtcctcttt
gccttcgtgccccctactgaatactggaatggctgggcgtgtttcattgtctccatcatc
atgatcggcgtactgacagctttcatcggtgacctggcctcccacttcggctgcaccatt
ggtctgaaagattctgtgactgcggtagtgttcgtcgcgcttggaacttcagtaccagac
acatttgcaagcaaagtggccgccacccaggaccagtacgcagacgcgtccatcggcaac
gtcactggcagcaacgcggtgaacgtcttcctgggaatcggcgtggcctggtccattgct
gccatctaccacgcggccaacggggaacagttcaaagtgtcccctggcacgctagctttc
tctgtcactctcttcaccatttttgctttcatcaatgtgggggtgctgctgtatcggcgg
aggccagaaatcggaggtgagctgggtgggccccggactgccaagctcctcacgtcctcc
ctctttgtgctcctgtggctcttgtacattttcttctcctctctggaggcctactgccac
ataaaaggcttctaa

DBGET integrated database retrieval system