KEGG   Miniopterus natalensis: 107536290
Entry
107536290         CDS       T05883                                 

Gene name
B2M
Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107536290 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107536290 (B2M)
   05170 Human immunodeficiency virus 1 infection
    107536290 (B2M)
   05168 Herpes simplex virus 1 infection
    107536290 (B2M)
   05163 Human cytomegalovirus infection
    107536290 (B2M)
   05169 Epstein-Barr virus infection
    107536290 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107536290 (B2M)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   107536290 (B2M)
SSDB
Motif
Pfam: C1-set Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 107536290
NCBI-ProteinID: XP_016067434
LinkDB
Position
Unknown
AA seq 118 aa
MALSVALVVLALLCLSGLDAEPRTPKIQVYSRHPAENGKPNFLNCYVSGFHPPEIDIHLL
KNGKEMPAEKSDLSFSKDWSFYLLVHANFTPSAGDEYSCSVTHVTLPEPKKVKWDRYN
NT seq 357 nt   +upstreamnt  +downstreamnt
atggctctctccgtggccctggtcgtgctggcgctgctctgtctgtctggcctggacgct
gaaccgcgtactccaaagattcaggtttactcacgccatccagcagagaatggaaagcca
aatttcctaaactgctatgtgtctgggttccatccacctgagattgatattcatttgctg
aagaatggaaaagagatgccagcggagaagtcagacctgtctttcagtaaggactggtct
ttctatcttctggtgcacgcaaatttcactcccagcgcaggagatgaatacagctgctct
gtgactcacgttactctccctgagcccaagaaagttaagtgggatcgatacaactaa

DBGET integrated database retrieval system