KEGG   Miniopterus natalensis: 107536359
Entry
107536359         CDS       T05883                                 

Gene name
SLX4IP
Definition
(RefSeq) protein SLX4IP
Organism
mna  Miniopterus natalensis
SSDB
Motif
Pfam: UPF0492
Other DBs
NCBI-GeneID: 107536359
NCBI-ProteinID: XP_016067508
LinkDB
Position
Unknown
AA seq 407 aa
MASKKFAIKCGDFAVLVDLHVSPQGSNKDTSWFSEQNKEEVCLLLKETINSRVKEYLEVR
KQHRPSNSEFTRSSPLSLKGYGFQITAYFLKRGIRLRCFGGSQSPELRVFPDRFVVCVSQ
LALTCDLSRQDELTERALRGASDYFAECAVSPLPPSAKLKRNTLKEIMKRAETKSSIMSK
SKSSRDIVGTSSDSVIAELAVKNSDRQASSSAPSESPGQAKDYIQAAESHRGLSVQKLEN
VHQAQPEDTSSQQKPHPGEWLETGPLSGSPVWSCESASPGPKQSPRGARTQQRRRNRGSA
QGSDHHRRVSLGSDRFVPREIRVEKSKAVRVLPTLELSDPGLLLKQDLAKTTSNEELHVL
ENLSSRHLMKTKPGKAEQTGSATNTERLATTQGSPTKKRKKYERATD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcatcaaagaaatttgctattaaatgcggggattttgctgtcctggtggatcttcac
gtatcaccgcaaggttcaaacaaagataccagctggttttctgaacagaacaaagaggaa
gtctgtttactgttaaaagaaaccattaattcaagagttaaggagtacttggaagttcgt
aaacagcacaggccatcaaattcagaattcacaagatccagtcccttgtccttaaaaggt
tatggctttcaaatcacagcctatttcctcaagagaggaatacgccttcgctgtttcgga
ggttcacagagtcctgaacttcgcgtattccctgacagatttgtagtctgtgtaagtcag
cttgcactcacttgtgatctttcaaggcaggatgaattgacggaaagagctcttcgcgga
gcatctgattattttgctgagtgtgcagtgagtccacttcctcccagtgcaaagctcaag
agaaacactctgaaagaaattatgaaaagagctgaaacaaaaagcagcatcatgagcaaa
tcgaagagcagtagggacattgtgggaacatcgagtgactcagtgattgcagagttggca
gtgaaaaacagtgaccgtcaggcttcatccagtgccccttcggagtccccggggcaagca
aaagattacatacaggcagctgagagccatcgggggctttctgttcaaaagctggaaaat
gttcatcaggcgcagccagaagacaccagcagccagcaaaaacctcatcctggggagtgg
ttagagacagggcctctaagcgggagccctgtctggagctgtgagtcagcatcaccaggt
ccaaaacaaagtccacgaggggccagaacacagcagagacgcaggaaccgcggctctgcg
cagggctccgaccaccacaggagagtttctcttggaagtgatcgattcgtccccagagaa
ataagagtggaaaaaagcaaagctgtcagggttctgccaactttggagctgtcagatccg
gggttacttttgaaacaagatttggcaaaaaccacgtctaatgaagagttgcatgttttg
gaaaatctctcctccagacatcttatgaaaactaagccagggaaggcagagcagactggc
tcagccacaaacactgaaagattagctacaacccagggcagcccaaccaagaaaaggaag
aagtacgaaagagccactgactga

DBGET integrated database retrieval system