KEGG   Miniopterus natalensis: 107536366
Entry
107536366         CDS       T05883                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04621  NOD-like receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107536366 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107536366 (PLCB4)
   04310 Wnt signaling pathway
    107536366 (PLCB4)
   04371 Apelin signaling pathway
    107536366 (PLCB4)
   04020 Calcium signaling pathway
    107536366 (PLCB4)
   04070 Phosphatidylinositol signaling system
    107536366 (PLCB4)
   04072 Phospholipase D signaling pathway
    107536366 (PLCB4)
   04071 Sphingolipid signaling pathway
    107536366 (PLCB4)
   04022 cGMP-PKG signaling pathway
    107536366 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107536366 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536366 (PLCB4)
   04613 Neutrophil extracellular trap formation
    107536366 (PLCB4)
   04621 NOD-like receptor signaling pathway
    107536366 (PLCB4)
   04062 Chemokine signaling pathway
    107536366 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    107536366 (PLCB4)
   04922 Glucagon signaling pathway
    107536366 (PLCB4)
   04929 GnRH secretion
    107536366 (PLCB4)
   04912 GnRH signaling pathway
    107536366 (PLCB4)
   04915 Estrogen signaling pathway
    107536366 (PLCB4)
   04921 Oxytocin signaling pathway
    107536366 (PLCB4)
   04926 Relaxin signaling pathway
    107536366 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    107536366 (PLCB4)
   04918 Thyroid hormone synthesis
    107536366 (PLCB4)
   04919 Thyroid hormone signaling pathway
    107536366 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    107536366 (PLCB4)
   04916 Melanogenesis
    107536366 (PLCB4)
   04924 Renin secretion
    107536366 (PLCB4)
   04925 Aldosterone synthesis and secretion
    107536366 (PLCB4)
   04927 Cortisol synthesis and secretion
    107536366 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536366 (PLCB4)
   04270 Vascular smooth muscle contraction
    107536366 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    107536366 (PLCB4)
   04971 Gastric acid secretion
    107536366 (PLCB4)
   04972 Pancreatic secretion
    107536366 (PLCB4)
   04973 Carbohydrate digestion and absorption
    107536366 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107536366 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536366 (PLCB4)
   04725 Cholinergic synapse
    107536366 (PLCB4)
   04728 Dopaminergic synapse
    107536366 (PLCB4)
   04726 Serotonergic synapse
    107536366 (PLCB4)
   04720 Long-term potentiation
    107536366 (PLCB4)
   04730 Long-term depression
    107536366 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    107536366 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    107536366 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    107536366 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107536366 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536366 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536366 (PLCB4)
   05016 Huntington disease
    107536366 (PLCB4)
   05017 Spinocerebellar ataxia
    107536366 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    107536366 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107536366 (PLCB4)
   04934 Cushing syndrome
    107536366 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107536366 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107536366 (PLCB4)
   05142 Chagas disease
    107536366 (PLCB4)
   05143 African trypanosomiasis
    107536366 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536366 (PLCB4)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107536366 (PLCB4)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107536366 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107536366 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 107536366
NCBI-ProteinID: XP_016067514
LinkDB
Position
Unknown
AA seq 1226 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRAGTTPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVDGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKTKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEALKSM
MEAGETAAPVSILEDDNEEEIESVDQEEEAHPEYKFGSELSADDLSHKEAVANSVKKVSD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEDSFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKTNVTPQ
SSSELRPTTTAALGSGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQEYYYTSGTKNIWVEETIHPKCEG
DAADGEIGSRDGPQTSNNSMKLQDAN
NT seq 3681 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctaacctggaaaagtgaaggcaaggaaggacaagtgctg
gaatgctccctcatcaacagcatccgcgcgggcaccacccccaaggaccccaaaatcctg
gctgccctcgaagctgttggaaaatcggaaaatgatctggaggggcggatagtttgtgtc
tgcagtggtacagatctggtgaacatcagcttcacttacatggtggctgaaaacccagaa
gtaactaagcaatgggtagacggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccgatgacctgcctcaagaaacactggatgaaattggcctttatgaccaacaca
aatggtaaaatcccagtgcggagtattactagaacctttgcatcggggaaaacagagaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cctgcggcatttacttacgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaggatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagaccctcgactcaatgaaattttattc
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcctgatgaagac
ttgaagacaaaaggcctgatatcaagtgatggattttgcagatatctgatgtccgatgaa
aacgctcccgtcttcctagatcgtctagaactttaccaagaaatggaccaccccctggcc
cactacttcatcagctcttcccacaacacctatctcaccggccggcagttcggcgggaag
tcttcggtggagatgtacagacaggtcctcctggccgggtgcagatgtgtcgagcttgac
tgttgggatggaaaaggtgaagaccaagaaccgataataactcatggaaaagcaatgtgc
acagatattcttttcaaggatgttattcaagccatcaaggaaactgcatttgtcacatct
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcgcat
ccactcgaaccaggcaggcccttgccatcccccaatgacctgaaaagaaaaatactcatc
aaaaataaacggctgaaaccggaggttgaacaaaagcagctcgaagctctgaagagcatg
atggaagccggagagacggcggccccggttagcatcttggaagatgataatgaagaggaa
atagaaagtgttgaccaagaggaagaagctcaccctgaatacaaatttggaagtgaactt
tctgccgatgacttgagtcacaaggaagctgttgccaatagtgtcaagaaggtttctgat
gaccttgaacatgaaaacaacaaaaagggcctggttacggtagaagatgaacaggcctgg
atggcatcttataaatatgtaggtgccaccactaatattcatccgtatctgtccacaatg
atcaactatgcacagcccgtcaagttccaaggtttccatgtggctgaagaacgcaatatt
cattataacatgtcttcttttaacgagtcagtcggcctaggctacctgaagacacacgcc
cttgagtttgtgaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gttgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcaggggaaatttgagtataat
ggatcgtgcgggtaccttctcaaaccagatttcatgagacggcctgatcggacctttgat
cctttctctgaaactcctgttgacggggttattgcagccacttgctcagtgcaggtcata
tcgggtcagttcttgtcagataagaaaatcggcacgtacgtggaagtggacatgtacggc
ctgcccacggacaccattcggaaggagttccgcacgcgcatggtgatgaacaacggcctg
aaccccgtgtacaacgaggactcgttcgtgtttcggaaggtaatcctcccggacctggcc
gtcttgaggatagcagtatatgatgacaacaacaggctcattggccagaggatcctcccg
ctggatggcctccaagccggctatcgacacatttcccttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaacattgtgcttaaaacatacgtgcctgatgggttt
ggagatattgtggatgctttatcagatccaaagaagtttctttcaattacagaaaaaaga
gcagaccagatgagagctatgggcatcgaaaccagtgacatagctgatgtgcccagtgac
acttctaagaatgacaagaaaggaaaggccaacactgccaaaacaaacgtgaccccacag
agcagctctgagctcagacccaccaccacggccgccttggggtccggcatggaagccaag
aaaggtattgaacttatccctcaagtgaggatagaagatttaaagcagatgaaggcctac
ttgaagcatttaaagaaacagcagaaggagctaaattctttaaagaagaaacatgcaaag
gagcacagtaccatgcagaagttacactgcacgcaagttgacaagatcgtggcacagtat
gacaaagagaagtcgactcacgagaaaatcctggagaaggcaatgaagaagaagggggga
agtaattgtctggagatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagattgtggcacagcacacaaaggagtggtcagaaatgatc
aacacccacagcgccgaggagcaggaaatccgggacctgcatctcagccagcagtgcgag
ctgctgaggaagctcctgatcagcgcccacgagcagcagacccagcagctgaaactgtcc
cacgacagggaaagcaaagaaatgagagctcaccaggctaagatttctatggaaaacagc
aaagccatcagccaagacaaatcgatcaagaacaaagcggaacgggaaaggcgagtcagg
gagttaaacagcagcaacactaaaaagtttctggaagaaagaaagagactcgcaatgaaa
cagtccaaagaaatggatcagttgaaaaaagtccagctcgaacacctagaattcctagag
aagcagaacgagcagcttttgaaatcctgtcacgcagtgtcccaaactcaagagtattat
tatacttcaggcacaaaaaatatctgggtagaggaaaccatccatcccaaatgcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacaatagtatg
aaactccaggacgcaaactga

KEGG   Miniopterus natalensis: 107536369
Entry
107536369         CDS       T05883                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04621  NOD-like receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107536369 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107536369 (PLCB1)
   04310 Wnt signaling pathway
    107536369 (PLCB1)
   04371 Apelin signaling pathway
    107536369 (PLCB1)
   04020 Calcium signaling pathway
    107536369 (PLCB1)
   04070 Phosphatidylinositol signaling system
    107536369 (PLCB1)
   04072 Phospholipase D signaling pathway
    107536369 (PLCB1)
   04071 Sphingolipid signaling pathway
    107536369 (PLCB1)
   04022 cGMP-PKG signaling pathway
    107536369 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107536369 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536369 (PLCB1)
   04613 Neutrophil extracellular trap formation
    107536369 (PLCB1)
   04621 NOD-like receptor signaling pathway
    107536369 (PLCB1)
   04062 Chemokine signaling pathway
    107536369 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    107536369 (PLCB1)
   04922 Glucagon signaling pathway
    107536369 (PLCB1)
   04929 GnRH secretion
    107536369 (PLCB1)
   04912 GnRH signaling pathway
    107536369 (PLCB1)
   04915 Estrogen signaling pathway
    107536369 (PLCB1)
   04921 Oxytocin signaling pathway
    107536369 (PLCB1)
   04926 Relaxin signaling pathway
    107536369 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    107536369 (PLCB1)
   04918 Thyroid hormone synthesis
    107536369 (PLCB1)
   04919 Thyroid hormone signaling pathway
    107536369 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107536369 (PLCB1)
   04916 Melanogenesis
    107536369 (PLCB1)
   04924 Renin secretion
    107536369 (PLCB1)
   04925 Aldosterone synthesis and secretion
    107536369 (PLCB1)
   04927 Cortisol synthesis and secretion
    107536369 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536369 (PLCB1)
   04270 Vascular smooth muscle contraction
    107536369 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    107536369 (PLCB1)
   04971 Gastric acid secretion
    107536369 (PLCB1)
   04972 Pancreatic secretion
    107536369 (PLCB1)
   04973 Carbohydrate digestion and absorption
    107536369 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107536369 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536369 (PLCB1)
   04725 Cholinergic synapse
    107536369 (PLCB1)
   04728 Dopaminergic synapse
    107536369 (PLCB1)
   04726 Serotonergic synapse
    107536369 (PLCB1)
   04720 Long-term potentiation
    107536369 (PLCB1)
   04730 Long-term depression
    107536369 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    107536369 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    107536369 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    107536369 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107536369 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536369 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536369 (PLCB1)
   05016 Huntington disease
    107536369 (PLCB1)
   05017 Spinocerebellar ataxia
    107536369 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    107536369 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107536369 (PLCB1)
   04934 Cushing syndrome
    107536369 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107536369 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107536369 (PLCB1)
   05142 Chagas disease
    107536369 (PLCB1)
   05143 African trypanosomiasis
    107536369 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536369 (PLCB1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107536369 (PLCB1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107536369 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107536369 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154 C2
Other DBs
NCBI-GeneID: 107536369
NCBI-ProteinID: XP_016067519
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRSDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISYLNLV
AFQEEVAKEWTNEVFSLATNLLAHNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNTSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTCSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGSKFIGHRILPVQAVRPGYHYISLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLDDEEEARR
EADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKAFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRVALEKTAKKDSKKRSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQSSQLKKLKELCEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPSSLASDPGKLNHRPPSS
EELEGDHPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctctgcaactcaagccggtgtgtgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactatcgtcactcca
attattttgaggtctgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctgctagatctcagcctcgtcaaggatgccagatgtgggagacatgcaaaggct
cccaaggaccccaaactacgtgaacttctggatgtggggaacatcggacgtctggaacat
cgcatgataacggtggtgtatgggcccgacttagttaacatctcctatttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccataacatgtccagggacgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatctaccgcttgttttcagct
gaccggaaacgagttgaaaccgctttagaggcttgtagtcttccatcttcaaggaatgat
tcgatacctcaagaagatttcactccagaagtgtaccgagttttcctgaacaacctttgc
cctcggcctgaaattgataacatcttttctgaatttggtgccaaaagcaagccatatctt
accgttgatcagatgatggatttcatcaacctcaagcagcgagatccccggctaaatgaa
atactttaccctcctttaaagcaagagcaagtccaagtattgattgagaagtatgaaccc
aacactagcctcgccaagaaaggacagatatccgtggacggctttatgcgctacctgagt
ggggaagaaaacggagtggtgtcacccgagaagctggatctgaatgaagatatgtcgcag
cccctttctcactatttcatcaattcctcgcacaacacctacctcacagctggacagctg
gctggaaactcctccgtcgagatgtatcgtcaagtgcttctttctggttgtcgctgtgtg
gagttggactgctggaaaggacggaccgcagaggaggaaccagtcatcactcatgggttc
accatgacgaccgaaatatccttcaaggaagtgatagaagcaatcgctgagtgtgcattt
aagacttcacctttcccaatcctcctttcatttgagaatcacgtggattccccgaagcag
caggctaagatggccgagtattgccgactgatctttggggacgcccttctcatggagcca
ctggagaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttggtgaaaaataagaagaaatcgcacaagtcgtcagaaggaagtggcaaaaag
aagctctcagaacaagcctccaacacgtgcagcgactcctccagcgtgttcgagccctcg
tctcccggagccggggaggctgatacggagagcgacgatgacgatgatgatgatgactgt
aaaaagtcttcaatggatgagggtactgctgggagtgaggccatggccacagaagagatg
tctaacctggtgaactatattcagcccgtcaagtttgagtcatttgaaatttccaaaaaa
agaaatagaagttttgaaatgtcttccttcgtggaaaccaaaggacttgagcaactgacg
aagtctccggtggaattcgtagaatataacaaaatgcagcttagcaggatatatccgaaa
ggaacacgtgtagattcgtccaactatatgcctcagctcttctggaatgcaggctgtcag
atggttgcccttaatttccaaaccgtggacctggctatgcagatcaatatggggatgtat
gagtacaatgggaagagcggctacaggctgaagccagagtttatgcggaggcctgacaag
cactttgacccgttcactgagggcatcgtggatgggatcgtggccaacacgttatccgtt
aagattatttcgggccagttcctttctgataagaaagtcgggacgtatgtggaagtggat
atgtttggcttgcctgtggacacaaggaggaaagcgtttaagaccaagacatcccaggga
aatgctgtaaaccccgtctgggaggaagagcccattgtgttcaaaaaggtggttcttccg
tcgctggcctgcctgaggatcgccgcttacgaagaggggagcaagtttatcggccaccgg
atcttgccggtgcaagcagttcggccaggctatcactacatctctctgaggaatgagagg
aaccagcccctgatgctcccggctgtcttcgtctacatagaggtgaaagactatgtccca
gatacctatgcagatgtgattgaagctctgtccaacccgatccgctacgtgaatctgatg
gagcagagagctaagcagctggccgctttgacgctggacgatgaagaggaggcaaggaga
gaggctgatcctggagaaacaccgtcagaggctccgagtgaagccaggacgaccccagca
gaaaatggagtgaatcacactacatccctggcacccaaacctccctctcaggctctccac
agccaacccgcgccaggctctgtgaaggcacctgccaaaacagaagatcttatacagagc
gttttaacagaagtggaagcgcagactattgaagagctaaagcaacagaaggcgtttgta
aaacttcaaaagaagcactacaaagaaatgaaagacctggtgaagagacaccacaagaaa
accacggaccttatcaaggaacacactaccaagtacaatgagattcagaatgactaccta
agaaggagggtggctttggaaaagacagccaagaaggacagtaagaaaagatcggaaccc
agcagccctgaccacggctcatccaccattgagcaagatcttgctgccctggatgccgaa
atgacccaaaagttaatagacttgaaggacaaacaacaacagcaactgctcaatcttcga
caagagcagtactacagtgaaaaataccagaagcgagaacatattaaactgcttatccag
aagctgacggacgtcgccgaggaatgccagagcagccagctgaagaagctcaaagagctg
tgtgagaaagagaagaaggagttaaagaagaaaatggataaaaagaggcaggagaagata
acagaagcgaagtccaaagacaaaagccagatggaagaggagaagacagagatgatccgg
tcctacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaactggtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggaactggagcaagagtaccaagacaagttcaaaagactgcccctggag
attctggagttcgtacaggaagccatgaaagggaagatcagtgaggacagcaatcacagt
tctgccccttcctccctggcctcagaccctggaaaactgaaccacaggcctccctccagt
gaggagctggaaggagatcacccaggaaaagagttcgatactcctctgtga

KEGG   Miniopterus natalensis: 107539797
Entry
107539797         CDS       T05883                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04621  NOD-like receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107539797 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107539797 (PLCB3)
   04310 Wnt signaling pathway
    107539797 (PLCB3)
   04371 Apelin signaling pathway
    107539797 (PLCB3)
   04020 Calcium signaling pathway
    107539797 (PLCB3)
   04070 Phosphatidylinositol signaling system
    107539797 (PLCB3)
   04072 Phospholipase D signaling pathway
    107539797 (PLCB3)
   04071 Sphingolipid signaling pathway
    107539797 (PLCB3)
   04022 cGMP-PKG signaling pathway
    107539797 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107539797 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107539797 (PLCB3)
   04613 Neutrophil extracellular trap formation
    107539797 (PLCB3)
   04621 NOD-like receptor signaling pathway
    107539797 (PLCB3)
   04062 Chemokine signaling pathway
    107539797 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    107539797 (PLCB3)
   04922 Glucagon signaling pathway
    107539797 (PLCB3)
   04929 GnRH secretion
    107539797 (PLCB3)
   04912 GnRH signaling pathway
    107539797 (PLCB3)
   04915 Estrogen signaling pathway
    107539797 (PLCB3)
   04921 Oxytocin signaling pathway
    107539797 (PLCB3)
   04926 Relaxin signaling pathway
    107539797 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    107539797 (PLCB3)
   04918 Thyroid hormone synthesis
    107539797 (PLCB3)
   04919 Thyroid hormone signaling pathway
    107539797 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    107539797 (PLCB3)
   04916 Melanogenesis
    107539797 (PLCB3)
   04924 Renin secretion
    107539797 (PLCB3)
   04925 Aldosterone synthesis and secretion
    107539797 (PLCB3)
   04927 Cortisol synthesis and secretion
    107539797 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107539797 (PLCB3)
   04270 Vascular smooth muscle contraction
    107539797 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    107539797 (PLCB3)
   04971 Gastric acid secretion
    107539797 (PLCB3)
   04972 Pancreatic secretion
    107539797 (PLCB3)
   04973 Carbohydrate digestion and absorption
    107539797 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107539797 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107539797 (PLCB3)
   04725 Cholinergic synapse
    107539797 (PLCB3)
   04728 Dopaminergic synapse
    107539797 (PLCB3)
   04726 Serotonergic synapse
    107539797 (PLCB3)
   04720 Long-term potentiation
    107539797 (PLCB3)
   04730 Long-term depression
    107539797 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    107539797 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    107539797 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    107539797 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107539797 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539797 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107539797 (PLCB3)
   05016 Huntington disease
    107539797 (PLCB3)
   05017 Spinocerebellar ataxia
    107539797 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    107539797 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107539797 (PLCB3)
   04934 Cushing syndrome
    107539797 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107539797 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107539797 (PLCB3)
   05142 Chagas disease
    107539797 (PLCB3)
   05143 African trypanosomiasis
    107539797 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107539797 (PLCB3)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107539797 (PLCB3)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107539797 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107539797 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 107539797
NCBI-ProteinID: XP_016071865
LinkDB
Position
Unknown
AA seq 1226 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRIGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLGPSQTRLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGVPNS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCAGLSNGEEAGPEKPSLEPRKSLGE
EGPQRGPDLGPADREEEEEEEEEEEQSDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVK
FKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMP
QLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVD
GIVANALRVKVISGQFLSDRKVSIYVEVDMFGLPVDTRRKFRTRTSQGNSFNPVWDEEPF
DFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIY
TEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGEREAQETCQETQSQQQGSQL
TPNPTPSSLDTSPRRPPGPVTSPTSPSLSSPGQRDDLIASILSEVVVTPLEELRGHKSLV
KLRSRQERDLRELHKKHQRKAFALTRRLLDSLAQARAESRCRPRPGVLGGEDEKEAAEEA
RRYLEFQERQVQSLLELREAQADAKAERRLEHLRQALQRLREIVLDAHTTQVKKLKEMND
REKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHE
RLVAGQQQVLQQLLEEEPKLLAQLAQECQEQRARLPQETRRSLLGETPEGLGDGHLVACA
SNGHAPGSSGHLSGADSESQEENTKL
NT seq 3681 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtcgtggag
accctgcggcgcgggagtaagtttatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgagtggaccccaatggcttcttcctgtactggacaggacccaacatggag
gtggacacattggacatcagttccatcagggacacacggataggccgttacgcccgcctg
cccaaggaccccaagatccgtgaggtgctgggttttggtggccctgatgccaggctagaa
gagaagctgatgacggtggtggctgggccagacccagtgaacacaacattcttgaacttc
atggccgtgcaggatgacacagccaaggtctgggctgaggagctgttcaagctggctatg
aacatcttggctcagaacgcctccaggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggacggatcccggtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcactggagtcctgtggcctcaattttaatcggagc
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagttg
tgtcttcggccggacattgacaagatcctgctggagataggtgccaagggcaagccgtac
ctgacattggagcagctcatggacttcatcaaccagaagcaacgggacccaagactcaat
gaagtgctgtacccgcccctggggccctcccagacccggctgctcattgagaagtatgag
cccaaccagcagttcctggagcgagatcagatgtccatggagggctttagccgctacctg
ggaggtgaagagaatggtatcctgccgctagaggctctggatctgagcgcagacatgacc
cagccactgagcgcctatttcatcaactcctcacacaacacctatctcacagcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctgtggggctgccgttgt
gtggagctggacgtatggaaagggcggccaccggaggaggagcccttcatcacccacggc
ttcaccatgaccacggaggtgccactgcgggatgtgcttgaggccatcgctgagacagcc
ttcaagacctcaccctacccggtcatcctctccttcgagaaccatgtggactcggcgaag
cagcaggccaagatggccgaatactgccgctccatctttggggatgcgctgctcatcgac
ccactggacaagtacccgctggccccgggcgtccccttgcccagccctcaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccggcctagtgctggcgtccccaacagc
tccgtgcgcaagcggcccctggagcagagcaactcggctctgagcgagagctccgccgcc
accgagccctcctcaccccagctcgggtcccccagctccgacagctgcgcaggcctgagc
aatggggaggaggcgggccctgagaagcccagcctggagcctcgcaagtctctgggcgag
gaggggccacagcggggcccagatcttggacctgccgatcgtgaagaggaggaagaggag
gaggaggaggaggagcagtcggaccccaagaagccgaccacagatgagggcactgctagc
agtgaggtcaatgctactgaggaaatgtcgacactcgtcaactatatcgagcctgtcaag
ttcaagtcctttgaggctgctcgaaagaggaacaaatgctttgagatgtcgtccttcgtg
gagaccaaggccatggaacagctgaccaagagtcccatggagtttgtggaatacaacaag
cagcagctcagccgcatctaccccaagggcacccgtgtggactcatccaactacatgccc
cagctcttctggaacgtgggctgccagctcgtggcactcaacttccagaccctggatgtg
gcgatgcagctcaatgcgggcgtgtttgagtacaacgggcgcagtggctacctgctgaag
cctgagttcatgaggcggccagacaagtcttttgaccccttcaccgaggtcatcgtggac
ggcattgtggccaatgccttgcgggtcaaggtgatctccgggcagttcctgtctgacagg
aaggtgagcatctatgtggaggtggatatgttcggcctccccgttgacacgcggcgcaag
ttccgcactcggacctctcaggggaactcgttcaaccccgtgtgggatgaggagcccttt
gacttccccaaggtggtgctgcccacactggcttcgctgcgcatcgcggcctttgaggag
ggtggcaagttcgtgggacaccggatcctgcccgtctctgccatccgctcagggtaccac
tacatctgcctaagaaacgaggccaaccagccactgtgcctgccagccctgctcatctac
actgaggcctccgactatatccctgacgaccaccaggactatgcagaggctttgatcaac
cccatcaagcacgtcagcctgatggaccagagggccaagcagctggccgccctcattggg
gagagggaggctcaggagacatgccaggagacgcagtctcagcagcaggggtcccagctg
accccaaatcccacacccagctcactggacacctctcctcgccggcccccaggccctgtc
acctcccctaccagcccttcccttagcagcccaggtcagcgggatgatctcattgccagt
atcctgtcagaggtggttgtgacccccttggaggagcttcgaggccacaagtctctggtg
aagctccggagtcggcaagagcgagacctgcgggagctgcacaagaaacatcagcggaag
gcattcgctctcactcgccgcttgctggacagcttggcccaggcccgggctgagagcaga
tgccggccgcggccgggtgtgctaggcggcgaggatgagaaggaggcggcggaggaggcg
aggcggtatctggagttccaggagaggcaggtgcagagcctgctggagctgcgggaggcc
caggcggatgccaaggccgagcggaggctggagcacctgagacaggctctgcagcggctc
agggagattgtcctggatgctcacacaactcaggtgaagaaactaaaggagatgaacgac
agggagaagaaggaactgcagaagatcctggacaggaaacgccacaacagtatctcagag
gccaagacaagggagaaacataagaaggaggcggaactgacagagattaaccgtcgccac
atcaccgagtcggtcaactccatccgtcggctggaggaggcccagaagcagcggcatgaa
cgccttgtggctgggcagcagcaggtcctgcagcagctgctggaagaggagcccaagctg
ctggcccagctggcccaggaatgtcaggagcagcgggccaggctgccccaggagacccgc
cggagcctgctgggcgagacgccggaggggctgggggacggacatctggtggcctgtgcc
agcaatggtcacgcgcctgggagcagtgggcacctgtccggcgctgactcggagagccaa
gaggagaatacaaagctctga

KEGG   Miniopterus natalensis: 107542967
Entry
107542967         CDS       T05883                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04621  NOD-like receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107542967 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107542967 (PLCB2)
   04310 Wnt signaling pathway
    107542967 (PLCB2)
   04371 Apelin signaling pathway
    107542967 (PLCB2)
   04020 Calcium signaling pathway
    107542967 (PLCB2)
   04070 Phosphatidylinositol signaling system
    107542967 (PLCB2)
   04072 Phospholipase D signaling pathway
    107542967 (PLCB2)
   04071 Sphingolipid signaling pathway
    107542967 (PLCB2)
   04022 cGMP-PKG signaling pathway
    107542967 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107542967 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542967 (PLCB2)
   04613 Neutrophil extracellular trap formation
    107542967 (PLCB2)
   04621 NOD-like receptor signaling pathway
    107542967 (PLCB2)
   04062 Chemokine signaling pathway
    107542967 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    107542967 (PLCB2)
   04922 Glucagon signaling pathway
    107542967 (PLCB2)
   04929 GnRH secretion
    107542967 (PLCB2)
   04912 GnRH signaling pathway
    107542967 (PLCB2)
   04915 Estrogen signaling pathway
    107542967 (PLCB2)
   04921 Oxytocin signaling pathway
    107542967 (PLCB2)
   04926 Relaxin signaling pathway
    107542967 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    107542967 (PLCB2)
   04918 Thyroid hormone synthesis
    107542967 (PLCB2)
   04919 Thyroid hormone signaling pathway
    107542967 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    107542967 (PLCB2)
   04916 Melanogenesis
    107542967 (PLCB2)
   04924 Renin secretion
    107542967 (PLCB2)
   04925 Aldosterone synthesis and secretion
    107542967 (PLCB2)
   04927 Cortisol synthesis and secretion
    107542967 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107542967 (PLCB2)
   04270 Vascular smooth muscle contraction
    107542967 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    107542967 (PLCB2)
   04971 Gastric acid secretion
    107542967 (PLCB2)
   04972 Pancreatic secretion
    107542967 (PLCB2)
   04973 Carbohydrate digestion and absorption
    107542967 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107542967 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107542967 (PLCB2)
   04725 Cholinergic synapse
    107542967 (PLCB2)
   04728 Dopaminergic synapse
    107542967 (PLCB2)
   04726 Serotonergic synapse
    107542967 (PLCB2)
   04720 Long-term potentiation
    107542967 (PLCB2)
   04730 Long-term depression
    107542967 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    107542967 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    107542967 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    107542967 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107542967 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542967 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542967 (PLCB2)
   05016 Huntington disease
    107542967 (PLCB2)
   05017 Spinocerebellar ataxia
    107542967 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    107542967 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107542967 (PLCB2)
   04934 Cushing syndrome
    107542967 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107542967 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107542967 (PLCB2)
   05142 Chagas disease
    107542967 (PLCB2)
   05143 African trypanosomiasis
    107542967 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107542967 (PLCB2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107542967 (PLCB2)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107542967 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107542967 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 MMACHC Gp58 AAA_13
Other DBs
NCBI-GeneID: 107542967
NCBI-ProteinID: XP_016075872
LinkDB
Position
Unknown
AA seq 1166 aa
MSVLNPVLLPPKVKAYLISGEHFIKWDDETTVASPVMLSVDPKGYYLYWTYQSKEKEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNLDFPDNTFLLKAFTVVSGPDMVDLTFHNFVSCKE
NVGKDWAEDILALVKHPLSANAPRATFLDKILVKLKMQLNPEGKIPVKNLFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPQSVYKSFLLNLCPRPEIDEIFTSHHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPQGMVWFLCGPEN
SVLAQDKLLVHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKLPEEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGSPLPSPEDLRGKILIKNKKNQFLGPAAPSKELGGE
AEGSCPPSAPVAEDTVLAAEEGAELEEQVEEEESELGNLDEEEMRKMQSDEGTAGLEVTA
YEEMSSLVNYIQPTKFISFEFSAQKNQSYVISSFTELKAYDLLSKAAVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RPDKQFNPFSVDGIDVVVATTLSIKVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKL
SPSANSINPVWNEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINILNSGYHHLCL
RSESNMPLTMPALFVLLEMKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAMGGLPE
KPFFSGSPVASQVNGAPASNGSAEPRTASLEELRELKGVVKLQRRQEKELRELERRGARR
WEELLQRGAAQLXXXXXXXXGGLGGCRLGPGKGSRKKRTQPREEVAGSRLGEGPEGADPR
AHELRDRLELELQQQGKEHYECVLKLKEQHLAEKIAKMMELAREKQAAELKTLKETSEND
TKEMKKKLEAKRLERIQAMMKSTTDKMAQERLKKEINNSHIQEVVQVINRMTESLERHQE
KLEEKQAACLEQIREMEKQFQQEALAEYEAKMKGLEAEVKESVRTCLRACFPSEAEDKLE
RPCGASRELCEQEPLTVNTDTQESCL
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgtgctcaaccctgtcctgctgccccccaaagtgaaggcctacctgatctccggg
gagcatttcatcaaatgggacgatgaaacaacagtagcctccccggttatgctctctgtg
gatcccaagggctattacttatactggacatatcagagcaaggaaaaggagtttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagattcccaagagccagaag
ctccgggatgtcttcaacctggattttcctgacaacaccttcctgctgaaggcattcact
gtggtgtctggccctgacatggtggacctcaccttccacaactttgtctcctgcaaagag
aatgtgggcaaggactgggctgaagatatactggctctggtcaaacacccgctgtcagcc
aacgccccccgcgccaccttcctggacaagattctggtgaagctcaagatgcagctcaat
cctgaagggaagattcctgtgaagaatttattccagatgtttcctgctgaccgcaagcgt
gtagaagctgccctcagtgcctgccacctccccaaaggcaaaaatgatgccatcaatcct
gaggacttcccacaatctgtctacaagagtttcctcttgaacctctgcccccggccagaa
atagatgagatcttcacttcccaccatgccaaggccaaaccctacatgaccaaggagcac
ttgaccaaatttatcaaccagaaacagagggatcctcgcctcaactccttattgttccca
ccagcgcggcctgaccaggtgcagggcctcattgacaaatatgagcccagtggcatcaac
gtgcagaggggccagctgtcaccccagggcatggtgtggtttctctgtgggccggagaac
agcgtgctggcccaagacaagctgctggttcaccaggacatgacgcagccgctcaatcat
tacttcatcaactcctcgcacaacacctacctgacagccggccagttctcaggcctctcc
tctgctgagatgtaccgccaggtgctgctggctggctgtcgctgcgtggagctggactgc
tggaaggggaagctccccgaagaggagcctattatcacccacggctttaccatgaccaca
gacatctacttcaaggaagcaattgaggcgattgcagaaagtgcctttaagacctccccc
tatcctgtcatcctgtcgtttgaaaaccacgtggactcaccccgccaacaggccaagatg
gctgagtactgccggaccatgtttggtgatatgctgctcacggagcccctggaaaagttt
ccactgaaaccaggcagccccctgcccagccccgaggatctccgtggcaagatcctcatc
aaaaacaagaagaaccagtttttgggcccagcagcccccagcaaggagctgggcggggag
gctgagggcagctgcccacccagtgcccctgtggcggaggacaccgtgttggctgctgag
gaaggggctgagctggaggagcaggtggaggaggaggagtcggagttgggaaacctggat
gaagaagagatgaggaagatgcagtcagatgagggcacagcgggcctggaggtgacggcc
tatgaggagatgtccagcctggttaactacatccagcccaccaagttcatctcctttgag
ttctctgcccagaagaaccaaagttatgtcatctcttcctttacggagctcaaggcttat
gacctgctctccaaggctgcagtgcagtttgttgactacaacaagcgccagatgagccgc
atttacccaaagggcacccgcatggactcctccaattacatgccccagatgttctggaat
gctggttgccagatggtcgccctcaacttccagacaatggacctgcccatgcaacagaac
atggcgctatttgagttcaatgggcagagtggctaccttctcaagcatgagttcatgcgc
cggccagacaagcagttcaaccccttctcggtggatggcatcgacgtggtggtagccacc
accctttccattaaggtaatctctgggcagttcctgtcagaacgcagcgtgcgcacctat
gtggaagtggagctgtttggcctacctggggaccccaagaggcgctatcgcaccaagctg
tcacccagtgccaactccatcaatcctgtctggaatgaggagccctttgtctttgagaag
atcttgatgcctgagctggcctccctcagggtggctgtgatggaggaaggcaacaagttt
cttggacaccgcatcatccccatcaatattctgaattctggataccaccatctgtgcctg
cgcagtgagagcaacatgcccctcaccatgcctgcgctctttgttctcctggagatgaag
gactatgtacctgacacctgggcagatctcaccgtggccctcgccaatcccatcaagttc
ttcagcgcccatgataagaagtctgtgaagctcaaggaagccatgggaggtctgcctgag
aagcccttcttttccgggagtccagttgccagccaggtcaacggggccccggccagcaat
gggtcagcagagccgcggaccgccagcctggaggagctgcgggagctgaagggcgtcgtg
aagctgcagcggcggcaggagaaggagctgcgggagctggagcggcgcggcgcgcggcgc
tgggaggagctgctgcagcggggcgcggcgcagctnnnnnnnnnnnnnnnnnnnnnnngg
ggcggcctcgggggctgcaggctcggcccgggcaagggctcccgcaagaagaggacccag
cccagggaggaggtcgccgggtccaggctgggcgagggccccgagggcgcggacccgcgc
gcgcatgagctgagggacaggctggagctggagctgcagcagcagggcaaggagcactac
gagtgtgtcctgaagctcaaggagcagcacctggccgagaaaattgccaagatgatggag
ctggccagagagaaacaggctgcagagcttaagaccctcaaggagacctcagagaatgac
accaaagagatgaagaagaagctggaggccaagaggctggagcggatccaggccatgatg
aagtctaccactgacaagatggcccaggagaggttgaagaaagagattaacaactcccac
atccaggaggtggttcaggtcatcaaccggatgacagagagcctggagaggcaccaggag
aagctggaggagaagcaggcagcctgcctggaacagatccgggagatggagaagcagttc
cagcaggaggcgctggcagagtatgaggccaagatgaagggcctggaggctgaggtgaag
gagtcggtgaggacctgcctcagggcctgcttcccctctgaggctgaggacaagcttgag
aggccctgtggggcctccagggagctgtgtgagcaggaaccacttacagtcaacacagac
acccaggagagctgcctctga

DBGET integrated database retrieval system