KEGG   Miniopterus natalensis: 107536406
Entry
107536406         CDS       T05883                                 

Gene name
ITPA
Definition
(RefSeq) inosine triphosphate pyrophosphatase isoform X1
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107536406 (ITPA)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107536406 (ITPA)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     107536406 (ITPA)
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-GeneID: 107536406
NCBI-ProteinID: XP_016067570
LinkDB
Position
Unknown
AA seq 213 aa
MRMLDDSLCNNGESLTNGDKCSFILEQVIQILGDKFPCTLVAKKIDLPEYQGEPDEISIQ
KCQEAAREVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYAL
CTFALSTGDPSEPVRLFRGRTSGRIVAPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNAI
SHRSRALRELQEYFGSLTSGTGDEHARPGSGEG
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagaatgttggatgacagcttgtgtaataatggggaatcattaacaaatggtgataaa
tgttctttcattttggaacaggtcattcagattctaggagacaagtttccatgtactttg
gtggcaaagaaaattgacctgccagagtaccagggagagcctgatgagatttccatacag
aagtgtcaagaggcagctcgcgaggtgcaggggcctgtactggtggaggatacctgcctg
tgcttcaatgcccttgggggcctccctggcccctacataaagtggtttctagagaagtta
aagcctgaaggtctccaccagctcctggccgggtttgaggacaagtcagcctatgcgctc
tgcacattcgctttgagcactggcgacccgagtgaaccagtgcgcctgttcaggggccgg
acttcgggccggattgtggcaccgcgaggctgccgggactttggctgggacccctgcttt
cagcctgatggatatgagcaaacgtatgcagagatgcccaaagctgagaagaatgccatc
tcccatcgctctcgggccctgcgtgagctgcaggagtactttggcagcttgacttctggg
accggtgatgagcatgctcgcccaggatctggggagggctag

DBGET integrated database retrieval system