KEGG   Miniopterus natalensis: 107536419
Entry
107536419         CDS       T05883                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107536419
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107536419
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107536419
   04612 Antigen processing and presentation
    107536419
   04658 Th1 and Th2 cell differentiation
    107536419
   04659 Th17 cell differentiation
    107536419
   04672 Intestinal immune network for IgA production
    107536419
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107536419
   05164 Influenza A
    107536419
   05168 Herpes simplex virus 1 infection
    107536419
   05169 Epstein-Barr virus infection
    107536419
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107536419
   05152 Tuberculosis
    107536419
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107536419
   05140 Leishmaniasis
    107536419
  09163 Immune disease
   05310 Asthma
    107536419
   05322 Systemic lupus erythematosus
    107536419
   05323 Rheumatoid arthritis
    107536419
   05320 Autoimmune thyroid disease
    107536419
   05321 Inflammatory bowel disease
    107536419
   05330 Allograft rejection
    107536419
   05332 Graft-versus-host disease
    107536419
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107536419
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107536419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107536419
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107536419
  Exosomal proteins of epithelial cells
   107536419
  Exosomal proteins of breast milk
   107536419
SSDB
Motif
Pfam: C1-set ig Ig_2 C2-set_2 DUF202
Other DBs
NCBI-GeneID: 107536419
NCBI-ProteinID: XP_016067589
LinkDB
Position
Unknown
AA seq 142 aa
APTVTVYPAKTRRLQHHNLLVCSVNGFYPGHIDVRWLRDGQEQEAGVVSTGLIRNGDWTF
QILVMLETVPQSGEVYTCQVQHPSRTSPLTAEWRAQSGSAQSKMLSGVGGFVLGLLFLGA
GLFVYFRNQKGHSGLQPAGLLS
NT seq 431 nt   +upstreamnt  +downstreamnt
ctgcgcctacagtgaccgtgtatcccgccaagacccggcgcctgcagcaccacaacctcc
tggtctgctctgtgaacggcttctatccaggccacattgacgtccgctggctgcgggacg
gccaggagcaggaggcgggggtcgtgtccacaggcctgatccggaatggagactggacct
tccagatcctggtgatgctggagacagttccccagagcggagaggtctacacctgccaag
tgcagcacccaagccggacgagccctctcaccgcggaatggagggcacagtctggatctg
cacagagcaagatgctgagtggagtcgggggcttcgtgctgggtctgctcttcctcgggg
cagggctgttcgtctacttcaggaatcagaaaggacactctggacttcagccagcaggcc
tcctgagctga

KEGG   Miniopterus natalensis: 107542667
Entry
107542667         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107542667
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107542667
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107542667
   04612 Antigen processing and presentation
    107542667
   04658 Th1 and Th2 cell differentiation
    107542667
   04659 Th17 cell differentiation
    107542667
   04672 Intestinal immune network for IgA production
    107542667
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542667
   05164 Influenza A
    107542667
   05168 Herpes simplex virus 1 infection
    107542667
   05169 Epstein-Barr virus infection
    107542667
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107542667
   05152 Tuberculosis
    107542667
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542667
   05140 Leishmaniasis
    107542667
  09163 Immune disease
   05310 Asthma
    107542667
   05322 Systemic lupus erythematosus
    107542667
   05323 Rheumatoid arthritis
    107542667
   05320 Autoimmune thyroid disease
    107542667
   05321 Inflammatory bowel disease
    107542667
   05330 Allograft rejection
    107542667
   05332 Graft-versus-host disease
    107542667
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107542667
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107542667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542667
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542667
  Exosomal proteins of epithelial cells
   107542667
  Exosomal proteins of breast milk
   107542667
SSDB
Motif
Pfam: C1-set Ig_3 ig Ig_2 C2-set_2 Marek_A I-set
Other DBs
NCBI-GeneID: 107542667
NCBI-ProteinID: XP_016075582
LinkDB
Position
Unknown
AA seq 184 aa
MNVELDSAVGVCGCDGARRVTGRSWNTRGELLELRAPGPXVRGHSHEPHKAFALKRRVQP
KVNVPASKKGPLQHPNLLVCHVTDFYPGNIQVRWFQNGQEETVQLVSTNLIHNGDWTFQI
LVMLKMSPQQGDVYTCQVEHPSLDSPVTVDWKAQSDSSRTKMLTGVRGLVLGLFALVDDK
DLSQ
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaacgtggagcttgacagcgccgtgggtgtttgtggctgtgacggagctcggcgcgtg
accggcaggagctggaacacccggggggagctcctggagctaagggcgccggggccancc
gtgcggggacacagccacgagccgcacaaggctttcgccctgaagcgcagagtccagcct
aaagtgaacgtgcccgcctccaagaaggggcccctgcagcaccccaacctgcttgtctgc
cacgtgacagatttctatccaggcaacattcaagtccgctggttccagaatggacaggag
gaaacagtgcagcttgtgtccaccaatctaatccataacggagactggaccttccagatc
ctggtgatgctgaaaatgagcccccaacagggagacgtctatacctgccaagtggagcac
cccagcttggacagtcctgtcactgtagactggaaggctcagtcagattcttcccggacc
aagatgctgactggagtcaggggccttgtgctggggctctttgccctcgtggacgacaag
gacctcagccaatag

KEGG   Miniopterus natalensis: 107542672
Entry
107542672         CDS       T05883                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107542672
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107542672
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107542672
   04612 Antigen processing and presentation
    107542672
   04658 Th1 and Th2 cell differentiation
    107542672
   04659 Th17 cell differentiation
    107542672
   04672 Intestinal immune network for IgA production
    107542672
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542672
   05164 Influenza A
    107542672
   05168 Herpes simplex virus 1 infection
    107542672
   05169 Epstein-Barr virus infection
    107542672
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107542672
   05152 Tuberculosis
    107542672
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542672
   05140 Leishmaniasis
    107542672
  09163 Immune disease
   05310 Asthma
    107542672
   05322 Systemic lupus erythematosus
    107542672
   05323 Rheumatoid arthritis
    107542672
   05320 Autoimmune thyroid disease
    107542672
   05321 Inflammatory bowel disease
    107542672
   05330 Allograft rejection
    107542672
   05332 Graft-versus-host disease
    107542672
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107542672
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107542672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542672
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542672
  Exosomal proteins of epithelial cells
   107542672
  Exosomal proteins of breast milk
   107542672
SSDB
Motif
Pfam: MHC_II_alpha C1-set FAST_1 SKG6
Other DBs
NCBI-GeneID: 107542672
NCBI-ProteinID: XP_016075588
LinkDB
Position
Unknown
AA seq 255 aa
MDHEGGPGPALLLHLLWLLPHAQTAPQAAGWPDLQNHTFQHTMYCQDWSPNVGLSEAYDE
DLLFSFDFSQNTRVPRLPEFADWAQKPGDSSNIFFDKAFCQAMVREIGPKLEGQIPVSRG
LPVAEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVTWQHHAAPVEGAGPTFVSAINGLSFQ
AFSYLNFTPSSSDLFSCLVTHEIDGYTAIAYWVPHNPLPSDLLENVLCGLAFGLGVLGIV
VGLVLIVCFRRPCSD
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatcatgaggggggcccaggaccagcgctgctgctacacctcctgtggctgctgccc
cacgcccagaccgcccctcaagccgcagggtggccagacctacagaaccacacgttccag
cacacaatgtactgtcaggactggagtcccaacgtcggactctctgaggcttacgatgag
gacctgcttttctccttcgacttttcccagaacactcgagttcctcgcctgcctgaattt
gctgactgggcccagaagcctggagattcttccaacattttctttgataaagccttctgc
caagccatggtccgggaaataggcccaaaattagaagggcaaatcccagtgtctagaggg
cttcctgttgccgaggtgttcacgctgaagcccctggagttcggcaagcccaacacactg
gtctgctttgtcagtaacctcttcccacccaccctgacggtgacctggcagcatcatgca
gcccctgtggaaggcgcggggcctacttttgtctcagccatcaatggactcagcttccag
gccttttcttacttaaacttcacaccctcatcctcggacctcttctcctgcctcgtgact
catgagatcgacggctacacagcaattgcctactgggtgccccacaacccgctgccctca
gatcttctggagaatgtgctgtgcggcctggccttcggcctgggtgtgctgggcatcgtc
gttggcttggtgctcatagtctgcttccggaggccttgttcagattga

KEGG   Miniopterus natalensis: 107542674
Entry
107542674         CDS       T05883                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107542674
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107542674
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107542674
   04612 Antigen processing and presentation
    107542674
   04658 Th1 and Th2 cell differentiation
    107542674
   04659 Th17 cell differentiation
    107542674
   04672 Intestinal immune network for IgA production
    107542674
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542674
   05164 Influenza A
    107542674
   05168 Herpes simplex virus 1 infection
    107542674
   05169 Epstein-Barr virus infection
    107542674
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107542674
   05152 Tuberculosis
    107542674
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542674
   05140 Leishmaniasis
    107542674
  09163 Immune disease
   05310 Asthma
    107542674
   05322 Systemic lupus erythematosus
    107542674
   05323 Rheumatoid arthritis
    107542674
   05320 Autoimmune thyroid disease
    107542674
   05321 Inflammatory bowel disease
    107542674
   05330 Allograft rejection
    107542674
   05332 Graft-versus-host disease
    107542674
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107542674
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107542674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542674
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542674
  Exosomal proteins of epithelial cells
   107542674
  Exosomal proteins of breast milk
   107542674
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 I-set ig SPARK
Other DBs
NCBI-GeneID: 107542674
NCBI-ProteinID: XP_016075590
LinkDB
Position
Unknown
AA seq 263 aa
MTTLLRLLLGLSLGCSGAGGFLAHVESTCLLDDNGIPQDFTYCVSFNKDLLSCWDPKEKA
MTPCEFGALNILAKYLSDSLNQQEKLLQRLSEGLQDCANHTQPFWGSLTQRTRPPSVQVA
KATPFNTREPVMLACYVWGFYPEDVTITWRKNGELVPPHGSAHKIVQPNGDWTYQTLSYL
ATTPAFGDTYTCVVEHIGAPEPILQHWTPGLSPEQTVKVSVSVATLGLGLIIFSLGLLSW
RRAGSSGYTSLPGSNYPEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccacactcctgcggctgctgctgggcctcagcctgggctgcagcggagcaggtggc
ttcctggcccatgtggaaagcacctgtctgcttgatgataatggaattccacaggatttc
acatactgtgtctccttcaacaaagatttgctgtcctgctgggatccaaaggagaaagca
atgaccccttgtgaatttggggcactgaatatcttggccaaatacctctcagattccctc
aaccagcaggaaaaactgctccagcgcttgtctgaggggctccaagattgtgccaaccac
acgcagcccttttggggatcgctgacccaaaggacaaggccgccatccgtgcaagtggcc
aaagccactcctttcaacacgagggagcctgtgatgctggcctgctacgtgtggggcttc
tacccagaggatgtgaccatcacgtggaggaagaacggggagcttgtcccccctcacggc
agtgcccataagattgtccagcccaatggggactggacataccagaccctctcctattta
gccacaacccccgcttttggggacacctacacctgcgtggtggagcacatcggggctcct
gagcccatccttcagcactggacacctggactgtccccggagcagacagtgaaggtttct
gtgtctgtggcaactctgggcctgggcctcatcatcttctctctgggtttgctcagctgg
cggagagctggctcctctggctatacttccctcccagggtccaattatccagaaggtcgg
cacatctcctag

KEGG   Miniopterus natalensis: 107544122
Entry
107544122         CDS       T05883                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107544122
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107544122
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107544122
   04612 Antigen processing and presentation
    107544122
   04658 Th1 and Th2 cell differentiation
    107544122
   04659 Th17 cell differentiation
    107544122
   04672 Intestinal immune network for IgA production
    107544122
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544122
   05164 Influenza A
    107544122
   05168 Herpes simplex virus 1 infection
    107544122
   05169 Epstein-Barr virus infection
    107544122
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107544122
   05152 Tuberculosis
    107544122
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107544122
   05140 Leishmaniasis
    107544122
  09163 Immune disease
   05310 Asthma
    107544122
   05322 Systemic lupus erythematosus
    107544122
   05323 Rheumatoid arthritis
    107544122
   05320 Autoimmune thyroid disease
    107544122
   05321 Inflammatory bowel disease
    107544122
   05330 Allograft rejection
    107544122
   05332 Graft-versus-host disease
    107544122
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107544122
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107544122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544122
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107544122
  Exosomal proteins of epithelial cells
   107544122
  Exosomal proteins of breast milk
   107544122
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 107544122
NCBI-ProteinID: XP_016077385
LinkDB
Position
Unknown
AA seq 254 aa
MAITGVPALGFFITVALMSLQESWAIKEDHVIIQAEFYLTPGSAGEFAFDFDGDEIFHVD
LDKSETVWRLKEFGDFASFEAQGALANIAVDKANLDTMIKRSNHTPNTNVPPEMTVLSSN
PVELGEPNVLICFIDKFSPPVINVTWLQNGKPVTTGVSETVFLPREDHLFRKFYYLPFLP
STEDVYDCKVEHWGLEKPLIKHWEFEGHSPLPETTENVVCGLGLVVGLVGIIVGTIFIIK
GVRKGQAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccatcaccggagtcccagcgttagggtttttcatcaccgttgccctgatgagcctt
caggaatcgtgggctatcaaagaggatcatgtgataatccaggctgagttctatctgacc
cctggctcggcgggcgagtttgcatttgactttgacggtgacgagattttccatgtggac
ttggataagagcgagacggtctggcggcttaaagaatttggtgattttgccagctttgag
gctcagggtgcattggccaatatcgctgtggacaaagccaacctggacaccatgataaag
cgcagcaaccacaccccgaacaccaatgtacctccagagatgactgtgctctcaagcaac
cctgtggaactgggagagcccaacgtcctcatttgctttatcgacaagttctccccacca
gtgatcaatgtcacatggcttcaaaatggaaaacctgtcacaacaggagtgtcggagacg
gtcttcctgcccagggaggaccaccttttccgcaagttctactatctccccttcctgccc
tcaactgaggatgtctatgactgcaaggtggagcactggggtttggagaagcctcttatc
aagcactgggagtttgaaggacacagcccactcccagagacaacagagaatgtggtgtgt
ggcctgggcttggttgtaggcctggtgggtatcatcgttgggaccatcttcatcatcaag
ggcgtgcgcaaaggccaggctgctgaacgccgtgggccactgtga

KEGG   Miniopterus natalensis: 107545091
Entry
107545091         CDS       T05883                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107545091
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107545091
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107545091
   04612 Antigen processing and presentation
    107545091
   04658 Th1 and Th2 cell differentiation
    107545091
   04659 Th17 cell differentiation
    107545091
   04672 Intestinal immune network for IgA production
    107545091
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545091
   05164 Influenza A
    107545091
   05168 Herpes simplex virus 1 infection
    107545091
   05169 Epstein-Barr virus infection
    107545091
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107545091
   05152 Tuberculosis
    107545091
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545091
   05140 Leishmaniasis
    107545091
  09163 Immune disease
   05310 Asthma
    107545091
   05322 Systemic lupus erythematosus
    107545091
   05323 Rheumatoid arthritis
    107545091
   05320 Autoimmune thyroid disease
    107545091
   05321 Inflammatory bowel disease
    107545091
   05330 Allograft rejection
    107545091
   05332 Graft-versus-host disease
    107545091
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107545091
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107545091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545091
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545091
  Exosomal proteins of epithelial cells
   107545091
  Exosomal proteins of breast milk
   107545091
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 ig Marek_A Ig_2
Other DBs
NCBI-GeneID: 107545091
NCBI-ProteinID: XP_016078619
LinkDB
Position
Unknown
AA seq 135 aa
APTVTVSPAKREALNHHNLLVCSVTDFYPSQVKVRWFRNDQEETGDAVSATPLIRNGDWT
YQILVMLEMTPQRGDVYTCHVEHPSLQSPVTVQWRAQSESARSKMLSGVGGLMLGLIFLG
LGLVIRHRKQKGLLR
NT seq 410 nt   +upstreamnt  +downstreamnt
tggcgcccacggtgaccgtctccccagccaagagagaggctctcaaccaccacaacctgc
tggtgtgctcggtgacggacttctatccaagccaggtcaaagttcggtggttccggaacg
accaggaggagacaggcgatgccgtgtccgccaccccccttattaggaacggggactgga
cctaccagatcctggtgatgctggaaatgaccccccagcgaggagacgtctacacctgcc
acgtggagcaccccagcctccagagccccgtaacagtgcagtggcgggcacagtctgaat
ctgccaggagcaagatgctgagtggcgtcgggggcttgatgctggggctgatcttcctcg
ggctgggccttgtcatccgtcacaggaaacagaaggggctcctgcgctga

KEGG   Miniopterus natalensis: 107545092
Entry
107545092         CDS       T05883                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107545092
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107545092
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107545092
   04612 Antigen processing and presentation
    107545092
   04658 Th1 and Th2 cell differentiation
    107545092
   04659 Th17 cell differentiation
    107545092
   04672 Intestinal immune network for IgA production
    107545092
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545092
   05164 Influenza A
    107545092
   05168 Herpes simplex virus 1 infection
    107545092
   05169 Epstein-Barr virus infection
    107545092
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107545092
   05152 Tuberculosis
    107545092
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545092
   05140 Leishmaniasis
    107545092
  09163 Immune disease
   05310 Asthma
    107545092
   05322 Systemic lupus erythematosus
    107545092
   05323 Rheumatoid arthritis
    107545092
   05320 Autoimmune thyroid disease
    107545092
   05321 Inflammatory bowel disease
    107545092
   05330 Allograft rejection
    107545092
   05332 Graft-versus-host disease
    107545092
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107545092
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107545092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545092
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545092
  Exosomal proteins of epithelial cells
   107545092
  Exosomal proteins of breast milk
   107545092
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 I-set
Other DBs
NCBI-GeneID: 107545092
NCBI-ProteinID: XP_016078620
LinkDB
Position
Unknown
AA seq 255 aa
MILNTALIWGALALTTVMGPCGGEDIVADHVAAYGINVYQSYGPSGQYTHEFDGDEEFYV
DLEKKETVWQLPVFIKFRSFDPQGALSNLAILKHNLDILIKRSNSTAATKKVPEATVFPK
EPVMLGQPNTLICAVDNIFPPVVNITWLSNGHPVTQGVSETSFLTKSDHSFLKISYLPFL
PSAENIYDCKVEHWGLDQPLLKHWEPEIPAPMSELMETVVCGLGLAVGLVGIVVGTVFII
QGLRPGGPSRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacacagctctgatttggggggccctcgcgctgaccaccgtgatgggtccc
tgtggaggggaagacattgtggctgaccacgttgccgcctatggcataaatgtctaccag
tcctatggtccctctggccagtacacccatgaatttgatggagacgaggagttctacgtg
gacctggagaagaaggagactgtctggcagctgcctgtgtttatcaaatttagaagtttt
gacccacagggtgcactgagcaaccttgctatattaaaacataacttggacatcctgatt
aaacgctccaactctaccgctgctaccaagaaggttcctgaggccactgtgtttcccaag
gagcccgtgatgctgggccagccaaacaccctcatctgtgccgtggacaacatcttccct
cctgtggtcaacatcacgtggctgagcaatgggcacccagtcacacagggcgtttctgaa
accagcttcctgaccaagagtgatcattccttcctcaagatcagttacctccccttcctc
ccttctgccgaaaacatttatgactgcaaggtggagcactggggcctggaccagccactc
ctgaagcactgggagcctgagattccagcccctatgtcagagctgatggagactgtggtc
tgtggcctggggctggctgtgggccttgtgggcatcgtggtgggcaccgtcttcattatc
cagggcctgcgcccagggggcccctccagacaccaagggccgttgtga

KEGG   Miniopterus natalensis: 107545174
Entry
107545174         CDS       T05883                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05164  Influenza A
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107545174
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107545174
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107545174
   04612 Antigen processing and presentation
    107545174
   04658 Th1 and Th2 cell differentiation
    107545174
   04659 Th17 cell differentiation
    107545174
   04672 Intestinal immune network for IgA production
    107545174
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545174
   05164 Influenza A
    107545174
   05168 Herpes simplex virus 1 infection
    107545174
   05169 Epstein-Barr virus infection
    107545174
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107545174
   05152 Tuberculosis
    107545174
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545174
   05140 Leishmaniasis
    107545174
  09163 Immune disease
   05310 Asthma
    107545174
   05322 Systemic lupus erythematosus
    107545174
   05323 Rheumatoid arthritis
    107545174
   05320 Autoimmune thyroid disease
    107545174
   05321 Inflammatory bowel disease
    107545174
   05330 Allograft rejection
    107545174
   05332 Graft-versus-host disease
    107545174
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107545174
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107545174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545174
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545174
  Exosomal proteins of epithelial cells
   107545174
  Exosomal proteins of breast milk
   107545174
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 ig Marek_A Ig_2
Other DBs
NCBI-GeneID: 107545174
NCBI-ProteinID: XP_016078728
LinkDB
Position
Unknown
AA seq 279 aa
MSGKRAPRTPGGLWAAAVMVGLAVLIAPGAEGRDSPGQAESERSLVEGRRELLWLLDSSV
LPAEGCRDGPREDTASEEMWRSLLSCFVGRGKSTDHTLARADEVAQVGWSPRLGVQGRHR
EAVPGEACWCSHISLPFLSVTPPVAPTVTVSPAKREALNHHNLLVCSVTDFYPSQVKVRW
FRNDQEETGDAVSATPLIRNGDWTYQILVMLEMTPQRGDVYTCHVEHPSLQSPVTVQWRA
QSESARSKMLSGVGGLVLGLIFLSLGLVIRHRKQKGLLR
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtctgggaagagggctccgcggacccccggcggcctttgggcagcagctgtgatggtg
gggctggcggtgctcattgccccaggggctgagggcagagactctccaggccaggccgaa
agcgagaggagccttgtggaggggcggcgagaactgctctggctcttagattcctcagtg
ttacctgctgagggctgtagagacgggccgcgcgaggacactgcttcggaggagatgtgg
cggtcactgctgtcctgctttgttggacgtggaaagtctactgatcacacgcttgctcgg
gctgatgaagtggcccaggtcggatggtccccccgtctgggggtccagggacggcacagg
gaggctgtccccggggaggcctgctggtgctctcacatctcactgcctttcctgtctgtt
actcccccagtggcgcccacggtgaccgtctccccagccaagagagaggctctcaaccac
cacaacctgctggtgtgctcggtgacggacttctatccaagccaggtcaaagttcggtgg
ttccggaacgaccaggaggagacaggcgatgccgtgtccgccaccccccttattaggaac
ggggactggacctaccagatcctggtgatgctggaaatgaccccccagcgaggagacgtc
tacacctgccacgtggagcaccccagcctccagagccccgtaacagtgcagtggcgggca
cagtctgaatctgccaggagcaagatgctgagtggcgtcgggggcttggtgctggggctg
atcttcctcagcctgggccttgtcatccgtcacaggaaacagaaggggctcctgcgctga

DBGET integrated database retrieval system