KEGG   Miniopterus natalensis: 107536502
Entry
107536502         CDS       T05883                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04217  Necroptosis
mna04612  Antigen processing and presentation
mna04621  NOD-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04659  Th17 cell differentiation
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna05132  Salmonella infection
mna05200  Pathways in cancer
mna05215  Prostate cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536502 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107536502 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536502 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107536502 (HSP90AA1)
   04612 Antigen processing and presentation
    107536502 (HSP90AA1)
   04659 Th17 cell differentiation
    107536502 (HSP90AA1)
   04657 IL-17 signaling pathway
    107536502 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107536502 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    107536502 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536502 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107536502 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536502 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536502 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536502 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107536502 (HSP90AA1)
   04131 Membrane trafficking [BR:mna04131]
    107536502 (HSP90AA1)
   03051 Proteasome [BR:mna03051]
    107536502 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107536502 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107536502 (HSP90AA1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107536502 (HSP90AA1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP90
   107536502 (HSP90AA1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107536502 (HSP90AA1)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107536502 (HSP90AA1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    107536502 (HSP90AA1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107536502 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 107536502
NCBI-ProteinID: XP_016067722
LinkDB
Position
Unknown
AA seq 732 aa
MPEETQAHDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDVGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEADEKEE
KEEERGKEDKEPEDKPEIEDVGSDEEEGEKKDGARKKKKIKEKYVDREELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADESSAAVTEEMPPLE
GDDDTSRMEEVD
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgccggaggagacccaggcccacgaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggaaatcgcccagctgatgtccttgatcatcaacactttctattcgaat
aaggagatcttcctgagggagcttatttcaaattcgtcagacgctctggacaagatcagg
tatgaaagcctgaccgaccctagtaagctagactctgggaaagagctgcacattaacctc
attccaaacaagcaagaccggaccctcaccatcgtggatacggggattggaatgaccaag
gccgatttgatcaataacctgggtactattgccaagtcgggaaccaaggcgttcatggaa
gccctgcaggctggcgcggatatctctatgatcggccagtttggtgtcggcttttattcg
gcctacttggttgctgagaaagtgactgtgatcaccaagcataacgacgacgagcagtat
gcctgggagtcttccgcgggagggtccttcacggtcaggaccgacgtaggggaacccatg
ggccgtggaacgaaggtcatcctgcacctgaaagaggaccagacggagtacctggaggag
aggaggatcaaggagatcgtgaagaagcactcccagttcatcggctaccccatcacactc
tttgtggagaaggagcgtgataaagaggtcagcgacgatgaggccgatgagaaggaggag
aaggaggaggagcgggggaaggaggacaaggagcccgaggacaagccggagatcgaggat
gtgggctctgacgaggaggagggagagaagaaggacggggcccggaagaagaagaagatc
aaggagaagtatgtggaccgggaggagctgaacaagaccaagcctatctggacccggaac
cctgacgacatcaccaacgaggagtacggggaattctacaagagcctgaccaacgactgg
gaggaccacttggcggtgaagcatttttcagtggaaggacagctggaattcagggcactt
ctttttgtcccaagacgtgctccctttgacctgtttgaaaaccgaaagaagaagaacaac
attaagctgtatgtgcgcagggttttcatcatggacaactgcgaggagctgatccccgag
tacctgaacttcattcgaggtgtggtagactctgaggatcttcctctaaatatttcccgg
gagatgctgcaacaaagcaaaattctgaaagtcatcagaaagaatttggtcaaaaaatgc
ttagaacttttcactgagctggcagaagataaggagaactacaaaaagttttacgagcag
ttctctaaaaacattaagcttggaatccatgaagactctcaaaatcggaagaagctctcg
gagctgttgcgatactacacatccgcgtctggtgacgagatggtctccctcaaggactac
tgcacacggatgaaggagaaccagaagcacatctactacatcacaggtgagaccaaggac
caggtcgctaactcggccttcgtggagcgcctccggaagcacggcctggaggtgatctac
atgatcgagcctattgatgagtattgtgtgcagcagctgaaggaattcgagggcaagact
ttagtgtcggtcaccaaagagggcctggaacttccagaagatgaagaagagaaaaagaaa
caggaagagaaaaaaaccaagtttgaaaacctgtgcaaaatcatgaaggacatcttggag
aaaaaagtggaaaaggtggttgtgtcaaaccgattggtgacatccccgtgctgcattgtc
acaagcacatatggctggacagcaaacatggaaaggatcatgaaggctcaagccctgaga
gacaactcaacaatgggttacatggcagccaagaaacacctggagataaacccagaccat
tccatcatcgagaccttgaggcagaaggcggaggcagacaagaacgacaagtctgtgaag
gacctggtcatcctgctctatgagactgcgctgctgtcctctggcttcagtctggaggac
ccccagacacatgctaacaggatctacaggatgatcaagctgggtcttggtatcgatgaa
gatgaccccactgctgacgagagcagtgctgctgtgaccgaagagatgccgcccctggaa
ggagacgacgacacctcacgcatggaggaagtcgactga

KEGG   Miniopterus natalensis: 107536915
Entry
107536915         CDS       T05883                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04217  Necroptosis
mna04612  Antigen processing and presentation
mna04621  NOD-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04659  Th17 cell differentiation
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna05132  Salmonella infection
mna05200  Pathways in cancer
mna05215  Prostate cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536915 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107536915 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536915 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107536915 (HSP90AB1)
   04612 Antigen processing and presentation
    107536915 (HSP90AB1)
   04659 Th17 cell differentiation
    107536915 (HSP90AB1)
   04657 IL-17 signaling pathway
    107536915 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107536915 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    107536915 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536915 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107536915 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536915 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536915 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536915 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107536915 (HSP90AB1)
   04131 Membrane trafficking [BR:mna04131]
    107536915 (HSP90AB1)
   03051 Proteasome [BR:mna03051]
    107536915 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107536915 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107536915 (HSP90AB1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107536915 (HSP90AB1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP90
   107536915 (HSP90AB1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107536915 (HSP90AB1)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107536915 (HSP90AB1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    107536915 (HSP90AB1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107536915 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 107536915
NCBI-ProteinID: XP_016068305
LinkDB
Position
Unknown
AA seq 725 aa
MPEEVVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESL
TDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQA
GADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGT
KVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEE
EDKDEEEKPKIEDVGSDEEDDSAKDKKKKTKKIKEKYIDHEELNKTKPIWTRNPDDITQE
EYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRR
VFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSEL
AEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKET
QKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKE
GLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWT
ANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLF
ETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASR
MEEVD
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtggtgcaccatggagaggaggaggtggagacttttgccttccaggca
gaaattgcccaactcatgtctctcatcatcaatactttctactccaacaaggaaattttc
ctccgggaattgatcagtaatgcttctgatgccttggacaagatacgctatgagagcctg
actgacccttccaagttggacagtggtaaagagctgaaaattgacatcatccccaacccc
caggaacgcaccctgactctggtggacacaggcattggcatgaccaaagctgatctcata
aataatctgggaaccattgccaagtctggtacaaaagcctttatggaggctcttcaggct
ggtgcagacatctccatgattggacagtttggtgttggcttttattctgcctatcttgtg
gcagagaaagtggttgtgatcacaaagcacaatgatgatgagcagtatgcctgggagtct
tctgctgggggttccttcactgtgcgagctgaccatggtgagcccattggccggggtacc
aaagtgattctccatcttaaagaagaccagacagagtacttagaggagcggcgggtcaaa
gaagtagtgaagaagcactcacagttcataggttatcctatcaccctttatttggagaag
gaacgagagaaagaaatcagtgatgatgaagcagaggaagagaaaggggagaaagaggag
gaagataaagatgaggaggagaagcccaagattgaagatgtgggctcagatgaggaggat
gacagtgccaaggataagaaaaagaaaacgaagaagattaaggagaagtatattgatcac
gaggaactgaacaagaccaagcccatttggaccagaaaccctgatgacattacccaggag
gaatatggagagttctataagagccttaccaatgactgggaagaccacttggcagtcaag
cacttctctgtagaaggtcagttggaattcagggcattgctgttcatcccccgtcgggct
ccctttgaccttttcgagaacaagaagaagaagaacaacatcaaactctatgtccgccgt
gtgttcataatggacagctgtgatgagctgatcccagagtatctcaacttcatccgcggt
gtggttgactctgaggacctgcccctgaacatctcccgagaaatgcttcagcagagcaaa
atcttgaaggtcattcgtaaaaacattgttaagaagtgccttgagctcttctctgagctg
gcggaagacaaggagaactataagaaattctatgaggcattttctaaaaacctgaagctt
ggaatccatgaagactcaactaatcggcgacgcctttctgagcttttgcgctatcacacc
tcccagtctggagatgaaatgacttctctttcagaatatgtttctcgcatgaaagagacc
cagaagtccatctattatattactggtgaaagcaaagagcaagttgccaactctgctttt
gtggagcgagtgcggaagcggggcttcgaggtcgtatatatgacggaacctattgatgag
tactgtgtgcagcagctcaaggaatttgatgggaaaagcttggtctcagttacgaaggag
ggcctggagctaccagaggatgaagaggagaaaaagaaaatggaagagagcaaggccaag
tttgagaatctctgcaaactcatgaaagaaatcttagataagaaggttgagaaggtgaca
atctccaataggcttgtgtcttcaccctgctgcattgtgactagcacctatggctggaca
gctaacatggagcggatcatgaaagcccaggcacttcgggataactctacaatgggctac
atgatggccaaaaagcacctggagatcaaccctgaccaccccattgtggagactctgcga
cagaaggcggaggcggacaagaatgacaaggctgtcaaggaccttgtggtgttgctgttt
gaaactgcgctgctgtcttctggcttctcactggaggatccccagacccactccaaccgc
atctatcgcatgatcaagctaggcctaggcattgatgaagacgaagtgacagcagaagaa
cccagtgctgctgttccagatgagatccccccccttgagggtgatgaggatgcttctcgc
atggaagaagtagactag

DBGET integrated database retrieval system