KEGG   Miniopterus natalensis: 107536540
Entry
107536540         CDS       T05883                                 

Gene name
MC1R
Definition
(RefSeq) melanocyte-stimulating hormone receptor
  KO
K04199  melanocortin 1 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107536540 (MC1R)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107536540 (MC1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107536540 (MC1R)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Melanocortin
    107536540 (MC1R)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107536540
NCBI-ProteinID: XP_016067776
LinkDB
Position
Unknown
AA seq 317 aa
MLVQGPQRRLLGILNSTSAATPHLRLATNQTGPRCLEVSIPDGLFLSLGLVSLVENVLVV
AAIAKNHNLHWPMYFFICCLAVSDLLVSISNMLGTAVMLLLEAGALAAQAPVVQQLDHVF
DVLICGSMVSSLCFLAAIAVDRYISIFYALRYHSIMTLPRTWWAIAAIWVASVISSTLFI
AYYDHTAVLLCLVSFFVAMLVLMAVLYVRMLVQACQHTRSITRLHKRQGTVPQGIGLKGA
ATLTTLLGVFFLCWGPFFLHLLLTVLCPQHPTCHCIFRNVNLFLALIICNAIADPLIYAF
QSEELRKTLQEVLLCSW
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcttgtacagggtccccagaggaggctgctgggcatcctcaactccacctctgcagcc
acccctcacctcaggctggccaccaaccagactggcccccggtgcctggaggtgtccatt
cctgatgggctcttcctcagcctggggctggtgagcctggtggagaacgtgctggtggtg
gccgctatcgccaagaaccacaacctgcactggcccatgtacttcttcatctgctgcctg
gccgtgtccgacctgctggtgagcataagcaacatgctggggacagccgtcatgctgctg
ctggaggcgggcgccctggctgcccaggcccccgtggtgcagcagctagaccacgtcttt
gacgtgctcatctgtggctccatggtgtccagcctctgcttcctggccgccattgccgtg
gaccgatacatttccatcttctatgctctgcgataccacagcatcatgacactgccccgg
acatggtgggcgatcgcagccatctgggtggccagtgtcatctccagcaccctcttcatt
gcctactatgaccatacagctgtcctgctctgtcttgtcagcttctttgtggccatgctg
gtgctcatggcagtgctatatgtccgaatgcttgtgcaggcatgccagcacacccgcagc
atcacccggctgcacaagaggcagggcacagtcccccagggcattggcctcaagggggct
gccactctcaccaccctgctgggtgttttcttcctctgctggggccccttcttcctgcac
ctcttgctcactgtcctctgtcctcagcaccccacctgccactgcatcttcaggaacgtc
aacctcttcctggccctcatcatctgcaacgccatcgcggacccccttatttatgccttc
caaagcgaggagctccggaagacgctccaagaggtgctgctgtgctcctggtga

DBGET integrated database retrieval system