KEGG   Miniopterus natalensis: 107536544
Entry
107536544         CDS       T05883                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536544 (PLA2G4D)
   00565 Ether lipid metabolism
    107536544 (PLA2G4D)
   00590 Arachidonic acid metabolism
    107536544 (PLA2G4D)
   00591 Linoleic acid metabolism
    107536544 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    107536544 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536544 (PLA2G4D)
   04014 Ras signaling pathway
    107536544 (PLA2G4D)
   04370 VEGF signaling pathway
    107536544 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    107536544 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536544 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536544 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    107536544 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    107536544 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536544 (PLA2G4D)
   04913 Ovarian steroidogenesis
    107536544 (PLA2G4D)
   04921 Oxytocin signaling pathway
    107536544 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536544 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536544 (PLA2G4D)
   04726 Serotonergic synapse
    107536544 (PLA2G4D)
   04730 Long-term depression
    107536544 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536544 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536544 (PLA2G4D)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536544 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536544
NCBI-ProteinID: XP_016067780
LinkDB
Position
Unknown
AA seq 817 aa
MERLTPREPPGHPHQREASACWRLTVRVLEARGLGWTDVLSEADPYVVLQMPTAPGIKFK
TKTVTNSSHPVWNESFSFLIQRQVKNVLELSVYDEDSVTEDDACFKFLYDISEVLPGKLL
RKTFSLRPQGQEELDVEFLMEKTSDRPENLITNNVLVARELSCLDIRLESMGSTAVVSNQ
ENLELELVLKGSYEDTQTSALGTASAFCFHYMVAQEAELSGRLKSSKGNGWNSGSSAGHF
TVPLKPLTMEKEMTIDIPATNAPGVRLQLKAKGCPEELAVRLGFDLCAEEKAFLSRRKQV
VAKALKKALQLDRDLQEDEVPIVGIMATGGGARAMTSLYGHLLALKKLGLLDCVTYFSGI
SGATWTMAQLYGDPEWSQKDLEGPIRHAREHLAKSKLEAFSPERLASYRRELELRAEEGH
PTTFVDLWALVLESMLHDQVMDQKLSGQRAALEQGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPSELFGSEFFMGQLMKRLPESRICFLEGIWSNIFSLNLLDAWY
DLTSSSDTWRQHIKDKIRNLEDPPASLKTSSWLEALWLQPGTALAQAFKGFLTGRLLYQH
SSNFLQGLQLHQDYCNQKAFSTWADSQLDSTPGQLTPQEPQLCLVDAGYFLNTSYPSMFR
PGRRLDLILSFDYSLSSPFEMLQQTEVYCRGLGLPFPHVEPSPQDQRQPKECHLFSDPTC
PDAPVLLHFPLVNASFKDHSAPGVQRDPTELLAGQVDLTGATSPYSLFNMTYKEEDFDRL
LQLSDYNVRKSQDAILQALRTVLKHQAPAARLPGAQS
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggagagactgacacctagggaaccacctggccatcctcatcagagggaggcttctgcc
tgctggcggctcactgtgagggtcctggaggctcgaggcctgggctggaccgacgtgttg
agcgaggcagacccctatgtggtcttacagatgccaactgcacctggaataaagtttaag
accaaaacagtcaccaactccagtcatcccgtatggaacgagagcttcagtttcctaatc
cagagacaggttaagaacgttctggagctgagcgtctatgatgaggactcagtcacggag
gatgacgcctgcttcaagtttctctatgacatctcagaagtcctccctggcaagctgctc
cggaagaccttctccctgcgcccccagggacaggaggaactggatgtggagttcctgatg
gaaaaaacgtcagaccgcccagaaaacctcatcaccaacaacgtccttgtggctcgagag
ctgtcatgcctggacattcgtctggagagcatggggagcacagccgtggtctcaaatcag
gagaacctggagctggagctggtgctgaaggggtcatatgaggacacacagacatctgcc
ctgggcacagcctctgctttctgctttcactacatggtggctcaagaggcagagctgagt
ggacgcctgaagagctctaaaggcaatggctggaactcaggcagctcagctgggcacttc
actgtgcctctgaagcccctcactatggagaaggagatgaccattgacattcctgctaca
aatgccccaggagtgaggttacagctcaaggctaagggctgcccagaggagctggccgtg
cgcctgggcttcgatctgtgtgcggaggagaaagctttcctgagcagaaggaagcaggtg
gtggccaaggccctgaagaaggccttgcagttggacagagacctacaggaagatgaggtc
cccatcgtagggatcatggccacaggaggaggtgccagggccatgacctctctctatggc
catctgttggctctgaaaaagctgggactcctggactgtgtgacgtacttcagcggcatc
tcgggagctacatggacaatggcccaactatatggggaccctgaatggtcacagaaggac
ctcgagggacccatccgacatgcccgagagcacctggccaagagcaagctagaagccttc
tccccagagagactggcaagctaccgcagggagctggagctgcgagcggaggaggggcac
cccaccacctttgtggacctgtgggctcttgtgctggagtccatgctgcacgaccaggtg
atggaccagaagctgtcaggacagagagccgcactggagcagggccagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaacctggagactcttgatttcaaggagtgg
gtcgagttctccccctatgaggtgggattcctgaagtatggagcctttgtcccttctgag
ctcttcggctctgagttcttcatggggcagctgatgaagaggctccctgagtcccggatc
tgcttcctggaaggcatctggagcaacattttctccctgaatttgctggacgcctggtat
gacctcaccagttctagtgatacctggaggcagcacatcaaggacaaaatcaggaacctg
gaggacccccctgcctccttgaagacctcctcatggttggaggccttgtggctgcagcca
ggaacggcgctggcccaggcatttaagggcttcctgacaggcagactgctctaccagcac
agttccaacttcctccagggcctccagctgcaccaggactactgtaaccagaaggctttc
tctacctgggcagacagccagctagactccacccctggccagctgaccccacaggagccc
caactctgcctggtggatgccggctacttcctcaataccagctatccctctatgttccgg
ccaggccgcaggctggacctcatactctccttcgactactctctatcctcaccttttgag
atgctacagcagactgaggtgtactgccgaggcctggggctgccattcccccacgtggag
cccagcccacaggaccagcgccagcccaaggagtgtcacctcttctcagaccccacctgc
cctgatgcgcctgttctgctacacttcccgttggtcaacgcctcctttaaggaccactca
gccccaggtgtccagcgcgaccctacagagctactggccggccaggtggatctcactggg
gccacctcaccctactccttgttcaacatgacctacaaggaggaagactttgaccgcctg
ctgcaactgagtgattacaatgttcggaagagccaggacgccatcctgcaggccttgagg
acagttctgaagcaccaggccccagcggccaggcttccaggggcacagtcttga

KEGG   Miniopterus natalensis: 107536549
Entry
107536549         CDS       T05883                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536549 (PLA2G4F)
   00565 Ether lipid metabolism
    107536549 (PLA2G4F)
   00590 Arachidonic acid metabolism
    107536549 (PLA2G4F)
   00591 Linoleic acid metabolism
    107536549 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    107536549 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536549 (PLA2G4F)
   04014 Ras signaling pathway
    107536549 (PLA2G4F)
   04370 VEGF signaling pathway
    107536549 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    107536549 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536549 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536549 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    107536549 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    107536549 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536549 (PLA2G4F)
   04913 Ovarian steroidogenesis
    107536549 (PLA2G4F)
   04921 Oxytocin signaling pathway
    107536549 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536549 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536549 (PLA2G4F)
   04726 Serotonergic synapse
    107536549 (PLA2G4F)
   04730 Long-term depression
    107536549 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536549 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536549 (PLA2G4F)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536549 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536549
NCBI-ProteinID: XP_016067788
LinkDB
Position
Unknown
AA seq 849 aa
MHWALWPQWLTSKGLPLLGVVLLRKREKRAPEWSHCRRETHPYYDLQVKVLRARNIQGKD
LLSKADCYVQLWLPTASPSHAQTRVIDNCSDPEWNETFHYQIHGAVKNVLELTLYDKDVL
GSNELSLLLFDLKSLKPGQPHKHTFLLNQQDSQELQVEFVLEKSQVPASEVITNGVLVAQ
PCLKIQGTLGGDETALHPKYGSRQVRLAVPGAYEKAQLLPLQPPLEGYPPDTFAFHVNPV
LRSRLLMEVGEKLTILQSDPSAELEAQTNNLGEGGILLSSLALGQEEQCLVAVGKGQEVS
LNVKAEMSSGDLDLRLGFDLCDGEREFLDKRKQIVSKALQQVLGLSQSPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELRLLDTVTYLGGVSGSTWCISTLYMDPSWSQVALQGPTE
RAQARVCSSKKGAVSTERLQYYAEELKNLESSNHSVSLIDLWGLIMEYFLYQEENPAKLS
DQQEAVSQSQNPYPIYASVNVRTNISGEDFAEWCEFTPHEVGFPKYGAYVPTKLFGSEFF
MGRLLKPWPEPRICYLQGVWGSAFAASLDEIFQKTAGFNLGFLDWHRGSVKVTGEDNQQR
LQDPTRLRTRLFTPQGPFSQAVLDIFTSRFTSAENFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDSLCLLDGGFAINSPFPLILLPQREVDLIVSFDYSLDAPFEVLQMTE
KYCQDRGIPFPRIEVLPEDLEEPGECYLFARAEDPGAPIVLHFPLVNGTFRTHLAPGVER
QTAEEKAFGDFDVNGPDTPYGMMNFTYEPEEFDRLVALSRYNVLNNVETIKKALQLALDR
RQAVGRAGS
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgcactgggcgctctggccacagtggctgacaagcaaggggctgcccctactgggggta
gtgttgctgcgaaagagagagaagagggcacctgaatggagtcactgccggcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccaggaatatccagggcaaagac
ctgttgtccaaagctgactgctatgtgcaactgtggctgcccacagcatctcccagccat
gcccagacaagagtgatagacaactgcagtgaccctgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaatgtcctggagctcaccctctatgacaaggacgtcctg
ggcagcaatgaactctccctgctgctgtttgacctgaagagcctcaagcctggccaaccc
cacaaacacactttcctactcaaccaacaggattcacaagagctacaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaatggtgtcctggtggctcag
ccctgtctgaaaatccagggcaccctagggggagacgagacagctctacatccaaagtat
ggctctaggcaagttcgtctggcagtgcctggggcctacgagaaagcacagctcttgccc
ctgcagcctcccttggagggctaccccccagacacctttgccttccacgtgaatccagtc
cttcgctctaggctgctcatggaggttggagagaagctcacgatcctgcagagcgacccg
agtgctgagctggaggctcagaccaacaatctgggtgaggggggcatcctgctctcctcc
ctggccctaggtcaggaggaacagtgcttggtggctgtggggaagggccaggaggtgtct
ctgaatgtaaaggcagaaatgagctctggggaccttgacttgcgccttggctttgacctc
tgtgacggggaacgagagtttctggacaagaggaagcagatcgtatccaaggccctgcag
caggtgctgggattgagccagtctcccgacagtggccaggtgcctgtggtggctgtgctg
ggctctggaggtggaacccgtgccatgtcttccctatacggcagcctagcagggctgcag
gagctccgtctcctggacactgtgacctacctgggtggggtgtcggggtctacctggtgc
atctccacactctacatggacccatcttggtcccaggtggccttgcagggccccactgag
cgagcccaggctcgggtctgcagcagcaagaagggggcagtgtccacggagcgcctacaa
tactatgccgaggaactgaagaacctggaaagcagcaatcacagcgtttcccttattgac
ctctggggcctcatcatggagtatttcctgtaccaggaggaaaacccagccaagctctct
gaccagcaggaggcagtcagccagagccagaacccttatcccatctatgccagtgtcaac
gtccgcaccaacatcagcggggaagactttgcagagtggtgcgagtttaccccccacgag
gtcggcttccccaagtatggagcttatgttcccaccaagctcttcggctcagagttcttc
atggggcgattgctgaagccctggccagagccccgaatctgctacctgcagggtgtatgg
ggcagtgcctttgcagccagcctggatgagatcttccagaagaccgccggctttaacctt
ggcttcctggactggcaccgtggcagcgtgaaggtcacaggtgaggataaccaacagagg
cttcaggaccccacgaggctgcgaacgagactcttcaccccccaggggcccttctctcag
gctgtgctagacatattcacctcccgcttcacctctgcggagaactttaacttcacccgt
ggcctctgtctgcacaaggactatgtggctggcagggagtttgtggcctggaaagacaca
cacccagacgccttccccaaccagctcactcccatgcgggactccctgtgcctgttggat
gggggctttgccatcaactctccattcccgctgatcctgctgccgcagagagaggtggac
ctcattgtgtcctttgactactccctggatgctccttttgaggtcttacagatgacagag
aagtactgccaggaccgcggcatccccttccccagaatcgaggtgctccctgaggacctg
gaggagcctggcgagtgctacctgtttgccagggcagaggaccccggtgcacccattgtg
ctgcacttcccccttgtcaacggtaccttccgcacacacttggctccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgacgtcaatgggccagacaccccctat
ggcatgatgaacttcacctatgagccggaggagtttgatcggctggtggccctgagccga
tacaatgttctgaacaacgtggagaccattaagaaggccctccagctggccctggaccga
cggcaggctgtgggcagggctggaagctga

KEGG   Miniopterus natalensis: 107536550
Entry
107536550         CDS       T05883                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536550 (PLA2G4E)
   00565 Ether lipid metabolism
    107536550 (PLA2G4E)
   00590 Arachidonic acid metabolism
    107536550 (PLA2G4E)
   00591 Linoleic acid metabolism
    107536550 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    107536550 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536550 (PLA2G4E)
   04014 Ras signaling pathway
    107536550 (PLA2G4E)
   04370 VEGF signaling pathway
    107536550 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    107536550 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536550 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536550 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    107536550 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    107536550 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536550 (PLA2G4E)
   04913 Ovarian steroidogenesis
    107536550 (PLA2G4E)
   04921 Oxytocin signaling pathway
    107536550 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536550 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536550 (PLA2G4E)
   04726 Serotonergic synapse
    107536550 (PLA2G4E)
   04730 Long-term depression
    107536550 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536550 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536550 (PLA2G4E)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536550 (PLA2G4E)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 107536550
NCBI-ProteinID: XP_016067789
LinkDB
Position
Unknown
AA seq 864 aa
MTLQALEGHPGLGADVLVSQSLQGDEEDSRSGRNVSEFEHTQDLETPDFPPLLPMAPWGS
QEGLSPCYLLTVRVIRMKNVRQADRLSQTDCYVSLWLPTASHEKLRTRTISNCPNPEWNE
SFNFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLKKLCFRKKTHVKFPLNPEGMEEL
EVEFLLEESPSPPETLITNGVLVARQVSCLEVHAESRRQRKNRKRKDLLVTVTESFEHTQ
RIPQSLESCCPNLAYFHYPKYFQSRMHVDMARSQGSCGLCCCGSHKRNNVVNQPLDCITD
GQAVTLPAGENCELHVKSTPCPQTLDVRLGYSLCQEELEFLEKRKVVVAKALKQVLQLEE
DLQMDEVPLITIMATGGGTRSMTAMYGHLLGLQKLNLLNCASHITGLSGATWTMATLYRD
PDWSSKNLEPAILEARRHVVKDKMPALFPDQLRKFREELRQRSQEGYKVNFTDFWGLLIE
ACLGDERNECKLSEQRAALSQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGMQKYG
AFVPTELFGSEFFMGRLMRRIPESRMCYLLGLWSSIFSVNLLDAWNFARSSEEFFHRWTR
EKVQDIEDEPLLPEIPKCDANALETSVVIPGSWLSNTFRHILTYRSFVSEFHNFLLGLQL
HTNYLQNGQFSKWKDTVLDSFPNQLTQSVNHLCLLDTAFFVNSSYPPLLRPERKADLIIH
LNYCAGSQTKPMKQTCEYCSVQNIPFPNYDIQEEGNNNLKECYLMKNSEEPDAPIVLFFP
LISDTFQKYKAPGVERSPEELEKGQVDIYGPKTPYATKELTYTEAAFDKLVNLCEYNILN
NKDQLLQALRMAVEKKKLLKNQCP
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgactctccaggccttggaaggccatcctggcctaggagctgatgtgcttgtctcacag
agcctacaaggggatgaagaagacagcaggtctggaagaaatgtcagtgagtttgagcat
acacaggacctggaaactcctgatttcccacctctccttcctatggccccgtggggctct
caggaggggctatctccatgctacctgctaaccgtgagggtcattcggatgaaaaacgtc
cggcaggctgacaggctgagccagacggactgctatgtgagcctctggctgcccaccgct
tctcatgagaagctgaggactagaaccatctccaactgcccaaacccagagtggaatgaa
agcttcaacttccagatccagagccaagtgaagaatgtgctagagctgagcgtctgcgat
gaagacacagtgacaccagatgaccatcttttgacagttctctatgacctcaaaaagctc
tgcttcaggaagaaaacccatgtgaagttcccactcaatccagagggcatggaggagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcatcaccaatggc
gtgctggtggctcgacaagtctcctgcctggaggttcatgcagaatccagaaggcagagg
aagaataggaaaaggaaggacctcctggtaacagtgacagagtccttcgagcacacccag
cgcatcccacagagcctggagtcctgctgcccaaaccttgcctacttccactaccccaag
tatttccagtcccggatgcacgtagacatggccagaagccaagggagctgtgggctttgc
tgctgcggctcgcacaagaggaacaacgttgtcaaccagcccctggattgcatcactgat
ggccaggcggtgaccctgcctgcgggagagaactgtgaattacacgtgaagtctacaccc
tgtccccagacgttggacgtgcggctgggctacagcctgtgccaggaagagctggagttc
ctggagaagcggaaggtggtggtggccaaggctctgaagcaggtgttgcagctggaggag
gacctgcagatggacgaggtgccgctcatcaccatcatggccactgggggtggaacaaga
tccatgaccgccatgtacggccacctgctggggctgcagaagctgaacctcctgaactgt
gccagccacatcactggcctgtcaggggccacctggaccatggcaaccttataccgtgat
cctgactggtcctccaaaaacctggagcctgccatccttgaggcccggaggcacgtggtc
aaggacaagatgcctgccctgttcccagaccagctccgcaaattccgggaggagctccgg
cagcgcagtcaggaaggctacaaggtcaactttacagacttctggggcctactgatcgag
gcctgtctgggggacgaaagaaatgaatgcaaactgtcagagcagcgtgctgctttgagc
cagggccagaaccccctgcccatctacctcaccatcaatgtcaaggacgatgtaagcaac
caggatttcagagagtggtgcgagttttccccgtacgaggtgggcatgcagaagtatggg
gccttcgtccccaccgagctcttcggttccgagttcttcatgggacggctgatgcggagg
atcccagagtctcggatgtgctacctgctaggtttatggagcagcatcttctctgtgaac
ctgctcgatgcctggaattttgcccgatcttcagaagagttttttcacaggtggacaagg
gagaaagtacaagacattgaagatgagccgctccttcctgaaatccccaaatgtgatgcc
aacgccctggagacctcggtggtgatcccagggtcatggctctccaatactttccgccac
atcctcacttaccgctcgtttgtgtctgagttccacaacttcctgctggggctgcagctg
cacaccaactacctccagaatggccagttctccaagtggaaagacactgtgcttgacagc
ttcccgaaccagctgacacagtccgtgaaccacttgtgtctgctggacactgcgttcttt
gtcaactccagctacccacccctcctcaggccggagaggaaagctgacctcatcatccac
ctcaattattgtgcagggtcccagacaaagccaatgaaacaaacctgtgagtactgctct
gtgcagaacatccccttccccaactatgacatccaagaggaggggaataacaatctcaag
gaatgctacctgatgaagaactccgaggagcctgatgcccccattgtgcttttcttccca
ctcatcagtgacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggag
ctggagaagggccaggttgacatttatggccccaaaactccctatgccaccaaggagctg
acatacacggaggctgccttcgacaagttggtgaacctctgcgagtacaacatcctgaat
aacaaagaccagctccttcaggccctgaggatggcagtggagaagaagaaactcctgaag
aaccagtgtccctag

KEGG   Miniopterus natalensis: 107536561
Entry
107536561         CDS       T05883                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536561
   00565 Ether lipid metabolism
    107536561
   00590 Arachidonic acid metabolism
    107536561
   00591 Linoleic acid metabolism
    107536561
   00592 alpha-Linolenic acid metabolism
    107536561
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536561
   04014 Ras signaling pathway
    107536561
   04370 VEGF signaling pathway
    107536561
   04072 Phospholipase D signaling pathway
    107536561
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536561
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536561
   04664 Fc epsilon RI signaling pathway
    107536561
   04666 Fc gamma R-mediated phagocytosis
    107536561
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536561
   04913 Ovarian steroidogenesis
    107536561
   04921 Oxytocin signaling pathway
    107536561
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536561
  09156 Nervous system
   04724 Glutamatergic synapse
    107536561
   04726 Serotonergic synapse
    107536561
   04730 Long-term depression
    107536561
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536561
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536561
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536561
SSDB
Motif
Pfam: Cupin_8 PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536561
NCBI-ProteinID: XP_016067821
LinkDB
Position
Unknown
AA seq 1014 aa
MAEVALEAVRRELREFPAAVRELSVPLAVPYLDKPPTPLRFYRDWVCPNRPCIIRNALKH
WPALQKWSLPYLRTTVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPLSCVLDVLEGRA
QHPGVLYVQKQCSNLPTELPQLLPDLEPHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLLHPPSDRPFIPYEMYTPATYQLTEEGFFKMVDEEAMEKAKVPGT
CLLTIRVLQARGLPSKDLVTPSDCYVTLWLPTASSHRLQTRTVKNSRNPIWNQSFRFRIH
NQLKNVVQLQVFDQDLLTSDDPVLSVLYDVGTLRIGEFRRESFPQSPQGEEQLEVEFRLQ
SLTDCAEQLVSNGILVGRELSCLHVRLEEAGDQNGSEGRVQLVVPGSCEGPQEASVGTAS
CFHCPACWEQELSVHLQDAPQEQLKVPLRVLPFGQVVRLVFPTSQEPLMRVELKKEEGPK
ELAVRLGCGPCAEEHAFLSRRKQVVAKALKQALQLDGDLQEDEIPVVAVMATGGGIRAMT
SLFGQLAGLRELGLLDCISYITGASGSTWALANLYEDPEWSQKDLAGPTKLLKTQVTKSK
LGVLAPSQLQRYRQELAERARLGYPTCFTNLWALINEALLHDEPHDHKLSDQREALSRGQ
NPLPIYCALNTKEKNLTTFEFAEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGRLMKRLP
ESRICFLEGIWSNLYAANLQDSLYWASEPRQFWDRWAQDQANLDKEQVPLLKIEEPPTVA
GRIAEFFTDLLTRRPLSQATHNFLYGLHFHKDYFQHPHFSTWKATKLDGLPNQLTPAEPY
LCLLDVGYFINTSCLPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRFCQEQGIPFPPISP
SPEEQRQPQECHLFLDPDCPEAPAVLHFPLVNNSFREHSAPGVRRTAEEAAAGEVNLSSS
NSPYHYSKVTYSQEDVDKLLHLTHYNICNNRERLLEALREAVRRRRQRKQRQPQ
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggaggtggctttggaagccgtgcggagggagttacgagaattccctgcggcggta
agggagctcagcgtgcctcttgctgtgccttacctggacaagcccccaactccgcttcgc
ttctaccgggactgggtctgccccaaccggccgtgtatcatccgcaatgccctgaagcat
tggccagccctccagaagtggtctctcccttacctcagaaccacagtgggctccacggag
gtgagtgtggctgttaccccagatggttatgcggatgctgtacgaggggaccgctttgtg
atgcccgctgagcgccgcctgcccctgagctgtgtgctggacgtgctagagggccgagcc
caacacccaggcgtcctctacgtgcagaagcagtgctccaacctgcccactgagctgccc
cagctgctgcctgatctggagccccatgttccctgggcctctgaggctctgggaaagatg
cctgatgctgtgaacttctggctgggggaggcggctgcagtgacatctttgcataaggac
cactacgagaacctctactgtgtggtctcgggagagaaacactttctgctacatccaccc
agtgaccggcccttcatcccctatgagatgtacactccagcaacctaccaactaactgaa
gagggcttctttaaaatggtggatgaggaggccatggagaaggcaaaggtgcctgggacc
tgcctgctcaccattcgtgtcctacaggcccgtggcctgccttccaaggatctagtgacc
ccctctgactgctatgtgactctgtggctgcccacggcctccagccacaggctccagaca
cgcacagttaagaacagcagaaaccccatctggaatcagagctttcgcttccggatccac
aaccagctcaagaatgtcgtacaactgcaagtctttgaccaggatcttttgaccagtgac
gaccccgtgttgtcggtgctgtatgacgtggggactttgcggattggggaattccgccgg
gaaagcttcccccagagccctcagggtgaggagcagctggaagttgaatttcgactgcag
agtctgacagactgtgctgagcagcttgttagcaatggcatcctggtgggccgggagctc
tcctgcttacatgttcgactggaggaggccggggaccagaatgggtcagaaggcagagtt
cagcttgtggttcctgggtcctgtgagggtccacaggaggcctcagtgggcactgcctcc
tgcttccattgcccggcctgctgggagcaggagctgagtgttcacctgcaggatgccccc
caggagcaactgaaggtgcccctgagggtcctgccctttggccaggtggtgagactcgtc
ttccctacgtcccaggagcctctgatgagggtggagctgaaaaaagaagaaggaccaaag
gagctggctgtgcggctgggctgtgggccctgtgctgaggagcatgccttcctgagcagg
aggaagcaggtggtggccaaggccctgaagcaggccctgcagctggatggagacctgcag
gaggatgagatcccagtggtagctgttatggccactggaggtgggatccgagccatgact
tccctgtttgggcagctggcaggtctgagggagctgggcctcttggattgcatctcctat
atcacaggggcctcgggatccacctgggctttggccaacctctacgaggacccagagtgg
tctcaaaaggacctggcagggcccaccaagttgctgaagacccaggtgaccaagagcaag
ctgggtgtgttggcccccagtcagctgcagcggtatcggcaggagctggccgagcgtgcc
cgcctgggctacccgacctgcttcaccaacctgtgggccctcatcaacgaggcactgctg
catgatgagccccatgatcacaaactctcagaccagcgggaggccctgagtcgaggccag
aatcctctgcccatctactgtgccctcaacaccaaggagaagaacctgactacctttgaa
tttgcagagtggtgcgaattctccccctatgaggtcggctttcccaagtacggcgccttc
atcccgtctgagctctttggctctgagttcttcatggggcgactgatgaagcggcttcct
gagtctcgaatctgcttcctggaaggcatctggagcaacctgtatgcagctaacctccag
gacagcttatactgggcctcagagccccgccagttctgggaccgctgggcacaggatcag
gccaacctggacaaggagcaggtcccccttctgaagatagaagagcctcccactgtggct
ggcaggatcgctgagtttttcactgaccttctgacgcggcgcccactttcccaggccacc
cacaatttcctatatggcctccatttccataaagactatttccagcatcctcacttctcc
acctggaaagccaccaaactggacgggctccccaaccagctgacacctgcagagccctac
ctttgcctactggatgttggctactttatcaacaccagctgccttcccctcctgcggccc
acaagggatgtggacctcatcctgtcgctggattacaacctccatggagcctttcagcag
ctgcagcttctgggccgattctgccaggagcaggggatcccattcccacccatctcgccc
agccctgaggagcagcgccagccgcaggaatgccacctgttcttggaccccgactgccct
gaagcccctgctgtgctgcacttccccctggtcaacaactccttccgggagcactcagcc
cctggggtccgccggacagctgaggaggcggcggctggggaggtgaacttgtcttcatcc
aactccccctatcactactcgaaggtgacctatagccaggaagatgtggacaagctgctc
cacctgactcattataacatctgcaacaaccgggagcggctgctggaggccctgcgtgag
gctgtgcggcggcggaggcaacgcaagcagcgccagccccagtga

KEGG   Miniopterus natalensis: 107546298
Entry
107546298         CDS       T05883                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107546298 (PLA2G4A)
   00565 Ether lipid metabolism
    107546298 (PLA2G4A)
   00590 Arachidonic acid metabolism
    107546298 (PLA2G4A)
   00591 Linoleic acid metabolism
    107546298 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    107546298 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546298 (PLA2G4A)
   04014 Ras signaling pathway
    107546298 (PLA2G4A)
   04370 VEGF signaling pathway
    107546298 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    107546298 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107546298 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107546298 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    107546298 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    107546298 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107546298 (PLA2G4A)
   04913 Ovarian steroidogenesis
    107546298 (PLA2G4A)
   04921 Oxytocin signaling pathway
    107546298 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546298 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546298 (PLA2G4A)
   04726 Serotonergic synapse
    107546298 (PLA2G4A)
   04730 Long-term depression
    107546298 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107546298 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107546298 (PLA2G4A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107546298 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 107546298
NCBI-ProteinID: XP_016080156
LinkDB
Position
Unknown
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDLLDTPDPYVELFISSTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSSPDLRFSMALCDQEKAFRCQRKENIKENMKKLLGPENSEG
LCSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGVLDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKRSGQPVTFADIFGMLIG
ETLIHNRMNMTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFTPYEIGMAKYG
TFMTPDLFGSKFFMGKVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSSSQNKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEDAAEEYQNDNQASWVHRMIMALMSDSTLFN
TREGRAGKVHNFMLGLNLNTSYPLSPFRDFNTQESLDEDELDTAVTDPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIIAFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPNVFDREGLKECYVFKPKNSDMEKDCPTVIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIFESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPPA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcattcatagatccttatcagcacattatagtggagcaccagtattctcacaagttc
acggtagtggtgttacgtgccaccaaagtgacaaagggggccttcggtgacctgcttgac
accccagatccctatgtggaactgttcatctcctcaacccctgacagcaggaagagaaca
agacacttcaataatgacatcaacccagtgtggaatgagacctttgaattcattttggat
cctaatcaggaaaacgttttggagatcacgttaatggatgctaattatgtcatggatgaa
actctggggacagcaacatttcccatatcttctatgaaagtaggagagaagaaagaggtt
ccttttattttcaaccaagtcactgaaatgattctggaaatgtcccttgaagtttgttcg
tccccagacctccgatttagtatggctctgtgtgatcaggagaaagctttcagatgccag
agaaaagaaaacataaaggaaaacatgaagaagctcctgggcccagagaatagcgaaggc
ttgtgttccacacgtgatgtgcctgtggtggccatactgggctcaggtgggggtttccga
gccatggtggggttctccggtgtgatgaaggcactgtatgaatcaggagttttagactgt
gctacctacattgctggtctttctggctccacatggtatatgtcaaccttatattctcac
ccagatttcccagagaaagggccagaagagattaatgaagagctaatgaaaaatgttagc
cacaacccccttttacttctcacgccacagaaagttaagagatatgtcgagtctttatgg
aagaagaaaagatctggacaacccgtcacctttgctgatatctttgggatgttaatagga
gagacactaattcacaataggatgaacatgaccttgagtagtttgaaggaaaaagtcaat
acagcccaatgccctttacctcttttcacgtgtctacatgtcaagcccgatgtttcagag
ctgatgtttgcagattgggtcgaatttactccctatgagatcggcatggctaaatatggt
actttcatgactcctgacttatttggaagcaaattttttatgggaaaagttgtaaagaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttctatattg
ttcaacagagtcttgggagtttccagctcacaaaataaaggctccacaatggaggaagaa
ttagaaaatattacagcaaagcatattgtgagtaatgatagctccgacagcgatgatgaa
tcacaagaacccaaaggcactgaaaatgaagatgctgcagaggagtatcagaatgataac
caggcaagttgggtccatcgtatgataatggccttgatgagcgactcaactttattcaac
accagagaaggacgtgctgggaaggtgcacaacttcatgttgggcctgaacctcaatacc
tcctacccgctgtctcctttcagagactttaacacacaggagtccttggatgaagatgaa
ctggacacagctgtaaccgatcctgatgaattcgagcgaatatatgagccactggatgtc
aaaagtaagaagattcacgtcgtggacagtggcctcacctttaacctgccttaccccttg
atcctgaggcctcagaggggagtcgatctcatcatcgcctttgacttttctgcaaggccg
agtgactctagccctccattcaaggaacttctccttgcggaaaagtgggcgaaaatgaac
aagctcccctttcccaagattgaccctaacgtgtttgatcgagaaggactgaaggagtgc
tacgtctttaaacccaagaactcagacatggagaaggattgccccactgtcatccacttt
gttctggccaacatcaacttcagaaagtacaaggccccgggtgtcccaagagaaactaag
gaagagaaagaaatagctgactttgatatttttgatgaccctgaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaagaggctgcatgatctgatgtacttcaat
accctgaacaacatcgatgtgataaagaacgccatctttgaaagcatcgaatatagaaga
cagaatccatctcgttgctctgtttccctcagtaacgttgaggcaagaagattcttcaac
aaggagtttctaagcaaacccccagcatag

DBGET integrated database retrieval system