KEGG   Miniopterus natalensis: 107536555Help
Entry
107536555         CDS       T05883                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00020  Citrate cycle (TCA cycle)
mna00190  Oxidative phosphorylation
mna01100  Metabolic pathways
mna01200  Carbon metabolism
mna04714  Thermogenesis
mna04932  Non-alcoholic fatty liver disease (NAFLD)
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05016  Huntington disease
Module
mna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mna_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107536555 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107536555 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    107536555 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536555 (SDHA)
   05012 Parkinson disease
    107536555 (SDHA)
   05016 Huntington disease
    107536555 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    107536555 (SDHA)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107536555 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 107536555
NCBI-ProteinID: XP_016067811
LinkDB All DBs
Position
Unknown
AA seq 551 aa AA seqDB search
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAF
GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGTIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIRE
GRGCGPEKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVLRHVNGRDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAE
SCRPGDKVPPIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQ
EGCEKISQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKERVDEYDYSKPIQGQQKKPFEQHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNESD
CATVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaattggaggtggcacttctatgacaccgtgaagggctctgactggctg
ggggaccaggacgccatccactacatgacagagcaggcccccgcctctgtggttgagcta
gagaattacggcatgccatttagcagaactgaggatgggaagatctaccagcgggccttt
ggcggacagagcctcaagtttgggaaaggcgggcaggcccatcggtgctgctgtgtggct
gaccgcactggccactcactgctgcacacgttgtatggaaggtctttgcgatatgatacc
agctattttgtagagtattttgctttggatctcctcatggaaaatggggagtgtcgtggt
gttatcgcactgtgcatagaagacgggaccatccatcgcataagagcaaagaacactgtt
atagctactggaggctatgggcgtacctacttcagctgcacgtctgcccacaccagcacc
ggagatggcactgcaatgatcaccagggcaggccttccctgccaggacttggagtttgtt
cagttccaccccacaggcatatatggtgctggttgtctcatcacagaagggtgccgcgga
gagggaggcattctcattaacagtcaaggcgagaggttcatggagcgatatgccccggta
gcaaaggacctagcctccagagacgtcgtgtcccgatccatgactctggaaatccgtgaa
ggaagaggctgtggccctgagaaagatcacgtctacctgcagttgcaccacctgcccccg
gagcagctggccatgcgcctgcctggcatttcagagacggccatgatctttgcgggtgtg
gacgtcaccaaggagccgatccctgttcttcccactgtgcattataacatgggtggcatt
cccactaactacaagggacaggtactgaggcatgtgaatggccgggaccaggtcgtgcct
ggcctgtacgcctgtggggaggctgcctgtgcctcggtgcatggtgccaaccgtcttggg
gcaaactcactcttggacttggttgtctttggccgggcatgtgccctgagtatcgcagag
tcctgcagacctggtgataaagttccacccattaaagcaaatgctggggaagaatctgtc
atgaatcttgacaaattgagatttgctgatggaagcataagaacatcggaactacgactc
aacatgcagaagtcaatgcaaaatcatgctgcagtgttccgtgtgggcagcgtcttacag
gagggctgtgagaaaatcagccagctctacggagacctaaagcatctgaagacgtttgac
agaggaatggtctggaacacagacctggtggagaccttggagctgcagaacctgatgctc
tgtgcccttcagaccatttatggagcagaggcccggaaggagtcacgtggtgctcatgcc
cgggaagattataaggagcgggttgatgaatatgattattccaaacccatccaagggcag
cagaagaagccatttgagcagcactggaggaagcacaccctttcctatgttgatgtcaag
actgggaaggtttcgctggaatacagacctgtaatcgacaaaactttaaatgagtctgac
tgcgccacagttcccccagccattcgctcctactga

DBGET integrated database retrieval system