KEGG   Miniopterus natalensis: 107536618
Entry
107536618         CDS       T05883                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2 isoform X1
  KO
K04364  growth factor receptor-bound protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04540  Gap junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536618 (GRB2)
   04012 ErbB signaling pathway
    107536618 (GRB2)
   04014 Ras signaling pathway
    107536618 (GRB2)
   04630 JAK-STAT signaling pathway
    107536618 (GRB2)
   04068 FoxO signaling pathway
    107536618 (GRB2)
   04072 Phospholipase D signaling pathway
    107536618 (GRB2)
   04151 PI3K-Akt signaling pathway
    107536618 (GRB2)
   04150 mTOR signaling pathway
    107536618 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107536618 (GRB2)
   04540 Gap junction
    107536618 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107536618 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107536618 (GRB2)
   04660 T cell receptor signaling pathway
    107536618 (GRB2)
   04662 B cell receptor signaling pathway
    107536618 (GRB2)
   04664 Fc epsilon RI signaling pathway
    107536618 (GRB2)
   04062 Chemokine signaling pathway
    107536618 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107536618 (GRB2)
   04912 GnRH signaling pathway
    107536618 (GRB2)
   04915 Estrogen signaling pathway
    107536618 (GRB2)
   04917 Prolactin signaling pathway
    107536618 (GRB2)
   04926 Relaxin signaling pathway
    107536618 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    107536618 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107536618 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107536618 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107536618 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536618 (GRB2)
   05206 MicroRNAs in cancer
    107536618 (GRB2)
   05205 Proteoglycans in cancer
    107536618 (GRB2)
   05203 Viral carcinogenesis
    107536618 (GRB2)
   05231 Choline metabolism in cancer
    107536618 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107536618 (GRB2)
   05225 Hepatocellular carcinoma
    107536618 (GRB2)
   05226 Gastric cancer
    107536618 (GRB2)
   05214 Glioma
    107536618 (GRB2)
   05221 Acute myeloid leukemia
    107536618 (GRB2)
   05220 Chronic myeloid leukemia
    107536618 (GRB2)
   05211 Renal cell carcinoma
    107536618 (GRB2)
   05215 Prostate cancer
    107536618 (GRB2)
   05213 Endometrial cancer
    107536618 (GRB2)
   05224 Breast cancer
    107536618 (GRB2)
   05223 Non-small cell lung cancer
    107536618 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    107536618 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107536618 (GRB2)
   05160 Hepatitis C
    107536618 (GRB2)
   05163 Human cytomegalovirus infection
    107536618 (GRB2)
   05165 Human papillomavirus infection
    107536618 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107536618 (GRB2)
   01522 Endocrine resistance
    107536618 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536618 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107536618 (GRB2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    107536618 (GRB2)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   107536618 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH2_2 SH3_3 DUF5093 hSH3 SH3_4
Other DBs
NCBI-GeneID: 107536618
NCBI-ProteinID: XP_016067915
LinkDB
Position
Unknown
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFSSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagccactgcagacgacgagctgagcttcaaa
agaggggacatcctcaaggttttgaatgaagaatgtgatcagaactggtacaaggcagaa
ctcaacgggaaagatggcttcattcccaagaattacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgcttagcaaacagcggcatgac
ggggccttcctcatccgagagagtgagagtgctcctggggatttctccctctctgtcaag
tttggaaatgacgtgcagcacttcaaggtgctccgagacggagccggaaagtactttctc
tgggtggtgaagttcagttctttgaatgagctggtagattatcacaggtccacgtccgtc
tccagaaatcagcagatattcctccgggacatagaacaggtgccacagcagccgacgtac
gtgcaggcgctctttgactttgacccccaggaggacggagagctggggttccgccgggga
gactttatccacgtcatggataactcggaccccaactggtggaagggggcctgccatggg
cagaccggcatgtttccccgcaattacgtcacccctgtgaaccggaatgtctag

DBGET integrated database retrieval system