KEGG   Miniopterus natalensis: 107536775
Entry
107536775         CDS       T05883                                 

Gene name
ERCC1
Definition
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03420  Nucleotide excision repair
mna03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    107536775 (ERCC1)
   03460 Fanconi anemia pathway
    107536775 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107536775 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107536775 (ERCC1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     107536775 (ERCC1)
SSDB
Motif
Pfam: Rad10 HHH_5 HHH HHH_2
Other DBs
NCBI-GeneID: 107536775
NCBI-ProteinID: XP_016068090
LinkDB
Position
Unknown
AA seq 294 aa
MDEGGVRPPSGPPTRKKFFVPLGEDEVPPAGAKPLFKSTRSHPTVETSAQAAPQTYAEYA
ISGPAGGAGATHPAGPEPQAGETPNQAPKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFG
DVVPDYVLGQSTCALFLSLRYHNLHPDYIHERLQSLGKSFTLRVLLIQVDVKDPQRALKE
LAKMCILADCTLVLAWSPEEAGRYLETYKAYEQKPADLLMEKMEQDFMSRVTECLTTVKS
VNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPR
NT seq 885 nt   +upstreamnt  +downstreamnt
atggacgaagggggagtgcggccaccctccgggccacccacaaggaagaaattcttcgta
cccctgggcgaggatgaggtccctcctgctggggccaagcccttattcaaatccactcgg
agccatcccaccgtggagacttcagcccaggcagcccctcagacctacgctgagtatgcc
atctcgggacctgcaggaggggctggagccacacaccccgcggggccagaaccccaggca
ggagagacccccaaccaggctcctaaaccaggggcaaaatccaacagcattattgtgagc
cctcggcagaggggcaaccctgtactgaagtttgtgcgcaacgttccctgggaatttggt
gacgtggttcctgactacgtgctgggtcagagcacctgtgccctcttcctcagcctccgc
tatcacaacctccacccagactacatccatgagcggctgcagagcctggggaagagcttc
accctgcgggtcctgctcatccaggtggacgtgaaagatcctcagcgggccctcaaggag
ctggctaaaatgtgcattctggcagactgcaccctggtccttgcctggagccctgaggag
gccgggaggtacctggagacctacaaggcctacgagcagaagccggcggacctcctgatg
gagaagatggagcaggacttcatgtcccgggtaactgaatgtctgaccacggtgaagtca
gtcaacaaaacagacagtcagaccctcctgactacttttgggtctctggaacagctcata
gctgcatcgagggaagatctggccttgtgcccaggcctggggccccagaaggcccgtagg
ctgtttgatgtcctacatgagcccttcttgaaagtgccccgatga

DBGET integrated database retrieval system