KEGG   Miniopterus natalensis: 107536793
Entry
107536793         CDS       T05883                                 

Gene name
PTGIR
Definition
(RefSeq) prostacyclin receptor
  KO
K04263  prostacyclin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
mna04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107536793 (PTGIR)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536793 (PTGIR)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536793 (PTGIR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107536793 (PTGIR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Lipid
   Prostacyclin
    107536793 (PTGIR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107536793
NCBI-ProteinID: XP_016068117
LinkDB
Position
Unknown
AA seq 386 aa
MADSCRNLTYVRDSVGPATSTLMFVAGVVGNGLALGILGARRRSRPSAFAVLVTGLAVTD
LLGTCFLSPAVFVAYARNSSLLGLARGHPVLCDTFAFAMTFFGLATTLILCTMAVERCLA
LSHPYVYAQLDGPRCARLALPAVYAFCTLFCSLPLLGLGQHQQYCPGSWCFIRLRSTEPG
GCAYSLAYASLVALLVTAIVFCNGSVTLSLCRMYRQQRRHQGSLVPGPGARAREDEVDHL
ILLALMTGIMAVCSLPLTIRGFTQAIAPDSSETGDLLAFRFNAFNPILDPWVFILFRKAV
FQRLKLWLCCLCPRPARAPLQSPLSQRASGGKDPRAPAALGGKEGNWVPLSAWGEARGAR
LPPAQRSGSTVGTLSKAESAAACSLC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcagactcctgcaggaacctcacttacgtgcgggactcggtgggcccggccaccagc
accctgatgttcgtggcaggtgtggtgggcaacgggctggccctgggcatcctgggggcg
cggcggcggtcacgcccatcggccttcgccgtcctggtcaccgggctggccgtcactgac
ctgctgggcacgtgtttcctgagccctgcggtgttcgtggcctacgcccgaaacagctcg
ctgctgggcctggcccgtggccaccccgtgctgtgcgacaccttcgccttcgccatgacc
ttcttcggcctggccaccacgctcatcctctgcaccatggccgtggagcgctgcctggcg
ctcagccacccctacgtctacgcccagctggacgggccgcgctgcgcccgcctggcgctg
cccgccgtctacgccttctgcaccctcttctgctccttgccgctgctgggcctgggccag
caccagcagtactgcccgggcagttggtgtttcatccgcctgcgctccaccgagccgggg
ggctgcgcctactccctggcctacgccagcctcgtggccctgctggtgactgccattgtc
ttctgcaacggctctgtcaccctcagcctctgccgcatgtatcgccagcagaggcgccac
cagggctcgctggtcccaggccccggggcacgggcacgcgaggacgaggtggaccacctg
atcctgctggccctcatgacaggcatcatggccgtgtgctccctgcctctcacgatccgc
ggcttcacccaggccatcgccccagacagcagtgagacgggggacctgctcgccttccgt
ttcaacgccttcaaccccatcctggacccctgggtcttcatccttttccgcaaggctgtc
ttccagcgcctcaagctctggctctgctgcctctgccccaggcccgcccgcgcgcccctg
cagagccccctgtcccagcgcgcctcgggggggaaggacccaagggcccctgccgctctc
ggggggaaggaggggaactgggtgcctctgtcggcctggggcgaggcgcggggggcacgc
ctgccccccgcgcagcgctcgggcagcaccgtgggaacgctgtccaaagcggagtccgcg
gcagcctgctccctctgctga

DBGET integrated database retrieval system