KEGG   Miniopterus natalensis: 107536808
Entry
107536808         CDS       T05883                                 

Gene name
GJA1
Definition
(RefSeq) gap junction alpha-1 protein
  KO
K07372  gap junction alpha-1 protein
Organism
mna  Miniopterus natalensis
Pathway
mna04540  Gap junction
mna05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107536808 (GJA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107536808 (GJA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107536808 (GJA1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107536808 (GJA1)
SSDB
Motif
Pfam: Connexin Connexin43 Connexin40_C Ammonium_transp 7tm_1
Other DBs
NCBI-GeneID: 107536808
NCBI-ProteinID: XP_016068138
LinkDB
Position
Unknown
AA seq 382 aa
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLSKREEELKVAQTDG
MNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHATTGPLSPSKECGSPKYTYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPASRASSRASSRPRPDDLEI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgactggagcgccttaggcaaactcctcgacaaggtccaagcctattccaccgcc
ggagggaaggtgtggctgtcagtgctcttcattttccggatcctgctgctgggcacggca
gtggagtcagcctggggcgatgagcagtcggccttccgctgtaacactcagcagcccggg
tgtgagaacgtgtgctacgacaagtccttcccgatctctcacgtgcgcttctgggtcctg
cagatcatcttcgtgtctgtccccacgctcttgtacctggctcacgtgttctacgtgatg
cggaaggaagaaaagctgagcaagagagaggaggaactcaaagtcgcccagaccgacggc
atgaacgtggagatgcacctgaagcagattgagatcaagaagttcaagtacgggatcgaa
gagcacggcaaggtgaaaatgcgagggggcttgctgagaacctacatcatcagcatcctc
ttcaagtctgtcttcgaggtggccttcttgctgatccagtggtacatctatggattcagc
ttgagcgctgtgtacacttgcaaaagagatccctgcccacatcaggtggactgcttcctc
tcccgccccacggagaaaaccatcttcatcatcttcatgctggtagtgtccttggtgtct
ctagccctgaacatcatcgaactcttctatgtcttcttcaagggcgtgaaggatcgtgtg
aagggcaagagcgatccttaccacgccaccaccggcccactgagcccctccaaagaatgt
ggatctcccaaatatacttatttcaatggttgctcttcaccaactgctcccctctcgccc
atgtctcctcccgggtacaagctggttactggagacagaaacaattcttcatgccgcaat
tacaacaaacaagcaagcgagcaaaactgggctaattacagtgcagaacagaatcggatg
ggacaggcaggaagcaccatctccaactcccacgcacagccttttgacttccccgatgac
aaccagaattctaaaaaactagccgccggacacgaactacagccgctagccattgtggac
cagcggcccgccagcagagccagcagccgcgccagcagccggcctcggcctgatgacctg
gagatctag

DBGET integrated database retrieval system