KEGG   Miniopterus natalensis: 107537017
Entry
107537017         CDS       T05883                                 

Gene name
MLLT4
Definition
(RefSeq) afadin isoform X1
  KO
K05702  afadin
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04520  Adherens junction
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107537017 (MLLT4)
   04015 Rap1 signaling pathway
    107537017 (MLLT4)
   04024 cAMP signaling pathway
    107537017 (MLLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107537017 (MLLT4)
   04530 Tight junction
    107537017 (MLLT4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107537017 (MLLT4)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 107537017
NCBI-ProteinID: XP_016068419
LinkDB
Position
Unknown
AA seq 1769 aa
MFKDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYS
LYEVHVSGEERRLDVDEKPLVVQLNWNKDDREGRFVLKNENDALPPKKAQSNGPDRQEKE
GVIQNFRRTLSKKEKKERRRDKGAPKQAGAEEPPPGVHTENSRLAAEVYKDMPETSFTRT
ISNPEVVMKRRRQQKLERRMQEFRSSDGRPDSGGTLRIYADSLRPNIPYKTILLSTTDPA
DFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPS
DRGILVFQLKRRPPDYVPKKAKKHLDGRPAKGKERADGASYGSALPPEKLPYLVELSPDG
SDSRDKPKLYRLQLSVTEVGTEKFDDNSIQLFGSGIQPHHCDLTNMDGVVTVTPRSMDAE
TYVEGQRISETTMLQSGMSVQFGASHVFKFVDPSQDHALVKRPVDGGLPTKGPRHKPGIV
QETTFDLGGDIHSGTALPTSKSSTRLDSDRVSSACSTAERGMVKPMVRVEQQPEHRRQES
RTQDAPGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQ
HRPEASPAERTHKAMAIVNKMVTMMEGVIQKQKNIAGALAFWMANASELLNFVKQDRDLS
RITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGA
MSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHVEAW
AEKQGLELAADCHLSRIVQATTLLTMDKYAPGDIPNISSTCFKLNSLQLQALLQNYHCAP
DEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIP
NGLQEFLDPLCQRGFCRLIPHARSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIIT
VTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGL
SQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRLSDRRGSGKPRPKSEGF
ELYNNSAQNGSPESPQLPWAEYSEPKKLPGDDRLLKNRADHRSSPNVANQPPSPGGRSAS
TPGTAAKITSVSTGNLCTEEQTPLPRPEAYPIPTQTYTREYFTFPASKSQDRAAPPPHSQ
WPTYEEEPHLHTDSSHPSISVQRVTRSQEELREDKAYALEPLRVEAVMDRKSDGDMWVFQ
SSSMGSSASSQEHLDHASKPGTPASTLTKSGPGRWKTPATGQPAPAAVPQPGRTDLPPPP
PPPPTHYTSEFDGIPMDLPLPPPPASQMGPPSAQVAAAERKKREEHQRWYEKEKARLEEE
RERKRREQERKLGQMRTQPLNPAPFSPVTVQPPTKPEKPATLQRPQETVIRELQPQQQPR
TIERRDLQYVTVGREELSSGDSLSPDPWKRDAREKLEKQQQMQIVDMLSREIQELQGKAE
RSAEESDRLRRLLLEWQFQRRLQEARQEEEEEEDDEVDTTLLARRLEAERRARDEERRRQ
QQLEEMRQREAEERARQEDQRLRQEEERGKRDAEEKRRQEEGYYSRLEAERRRLHEEAER
RLLEPEEPGLSRPPLPRGYEPPTLPTAAGAPPXXXXXXASYLQAQVLSPDSLYTAKLVAY
TEEEEDCGPAGPDSSMGSSGTLAGSRDANRDPREKPSKSQDADFPGSAGAPENLTFRERQ
RLFSQGQDVSNKVKASRKLTELENELNTK
NT seq 5310 nt   +upstreamnt  +downstreamnt
atgtttaaggatttggagttccatggagtgatgaggttttattttcaagataaagctgct
ggaaactttgcaaccaagtgtatccgggtctccagcacggccaccactcaggatgtcatt
gagacgctggccgagaagttccggcctgacatgcgcatgctgtcctcgcccaagtactcg
ctctacgaagtgcatgtcagtggagaagaaagaagattggatgtggacgagaagccccta
gttgtgcagctgaactggaataaggatgaccgagagggcaggtttgtcctgaagaatgag
aacgacgcccttcctcccaagaaggctcagagcaacggacccgacaggcaggagaaggag
ggcgtcatccagaacttccggcggaccctctccaagaaggagaagaaggagaggcggcgg
gacaagggggcgccaaagcaggcaggcgcagaggaacctccccccggtgtccacactgag
aattctcgcctggctgctgaggtttacaaagacatgcctgagaccagcttcacgcgcacg
atttctaaccccgaggtggtcatgaagcggcggaggcagcagaagctggagaggcgaatg
caggagttccggagctcagacgggcggcccgactcaggtggaacattgagaatttatgca
gatagtttaagaccaaatatcccctacaagacaatcctgctgtctactactgaccctgcg
gactttgctgtggctgaagctttggagaagtacggtttggagaaagaaaacccgaaggac
tactgcatcgcacgggtgatgcttcctcctggagcccagcattctgatgagagaggtgcc
aaggagatcatccttgatgacgacgagtgtcccttgcagatcttccgagagtggccaagc
gaccgagggattttagtctttcagttgaagaggaggcccccagactatgtccctaagaaa
gccaagaagcacctggatggcaggccggcaaagggcaaggagagagctgatggggccagc
tatggctctgccctgcctcctgaaaagctgccctacctggtggagttgagcccagatggt
tctgactccagggataagccgaagctctaccgcctgcagctcagtgtcaccgaggttggg
acggagaagtttgacgacaactctatccagctgtttggttcaggaattcagccccatcac
tgtgacctcacgaacatggacggtgttgtcactgtcacgcccaggagcatggacgcggag
acgtatgtggaggggcagcgcatctcggagacgaccatgctgcagagcgggatgagcgtg
cagtttggggcatcgcacgtgttcaagttcgtggaccccagccaggaccacgccctcgtg
aagaggcctgtggacgggggcctgcccaccaagggccccagacataaacctggcattgtt
caggagactacttttgacttaggaggcgatattcacagtggaacagcattgccaacaagc
aagagctcaactagactggacagcgacagggtgtcgtccgcctgcagcacagccgagcgg
gggatggtgaagccgatggtccgagtggagcagcagcccgagcaccgcaggcaggaaagc
aggacgcaggatgcccctgggcctgagctgattcttcctgcgagcatcgagttcagggag
agctctgaagattcatttttatctgccattataaattatactaatagctccaccgtccat
tttaagttgtcacctacgtatgtgctctatatggcatgtcgttacgtactgtccagccag
cacagacctgaagccagtcctgcagagcggactcacaaggcgatggccatagtcaacaag
atggtgaccatgatggaaggcgtgattcagaagcagaagaacatcgcaggggcgcttgct
ttctggatggcaaatgcgtccgagctgctcaactttgtcaaacaggaccgggacctgagt
cgaatcacactggatgcccaggacgtgctagcgcacctggttcaaatggcgtttaaatac
ctggtccactgtcttcagtcggaactgaataactatatgccagcctttctggatgacccc
gaagagaacagtctgcagagaccaaaaatagatgacgttctgcacacgctcacgggggcg
atgtcgctgctgcggcgctgccgggtcaacgcggccctgaccatccagctcttctcccag
ctcttccacttcatcaacatgtggctgttcaacaggctggtgaccgaccccgactcgggg
ctgtgctcccattattggggggccatcatccgccagcagctggggcatgtggaggcctgg
gcggagaagcaggggctggagctggctgcggactgtcacctcagcaggattgtacaggcc
accaccttgctcacgatggataagtatgcccccggcgacattcccaacataagcagcacc
tgcttcaagttaaactctctgcaacttcaggccttgctgcagaactaccactgcgcaccc
gatgagcccttcatccccacggacctcatagagaatgttgtggctgtggctgaaaacaca
gcggacgagctggcgcgcagcgatggacgggaggtgcagctggaggaggaccccgacctg
cagctgcccttcctcctgcccgaagacggctactcttgcgacgtagtcaggaacattccc
aatggcttacaggagtttttggaccctttgtgccagaggggattctgcaggttaattcct
cacgcacgctccccaggtacttggacgatctactttgagggtgcggactatgaaagtcac
cttctgcgcgagaacacagaactggctcagcctctgaggaaggagcccgagatcatcact
gtgaccctgaagaagcagaatggaatgggcctcagcattgtggcagcaaagggtgctggt
caggataagcttgggatctacgtcaagtctgttgtaaaaggaggtgctgctgatgtggat
gggcggctggccgcaggggaccagctcctcagtgtggatggacggagtctggtaggactc
tctcaagaaagggcagcagagctcatgacaaggacgagctccgtggtgacactggaagtt
gcgaagcaaggagccatctatcatggtctcgccaccctgctcaatcagccgtccccgatg
atgcagagattgtcagatcgccgtggctcaggcaaaccccgaccaaagagtgaaggcttc
gagctctataacaattcagctcagaacgggtcacccgagagccctcagctgccgtgggca
gagtacagcgaaccaaagaagttgcctggcgacgacagactactgaagaacagagctgac
caccggtctagccccaacgtagcaaatcagcctccgagtcctggcgggagaagcgcgtcc
acccccggaacagctgccaagataacgtccgtctccacaggaaacctctgcactgaggag
cagacacccctacctcgacccgaggcctaccccattcccacgcagacgtacaccagggag
tatttcacgttccccgcctccaagtcccaagaccgggcggctcctcctcctcacagccag
tggcccacctacgaggaagaaccacacctgcacacggacagcagtcaccccagtatttcg
gtgcagcgcgtgacccgttcccaagaggagctccgggaagataaagcttatgccctggag
cccctccgcgtagaggcagtgatggatcgcaagtctgacggcgacatgtgggtgttccag
agctcctccatgggctccagcgcatccagccaggagcacctggaccacgcatcaaagccg
ggcactcctgcgtccaccttgaccaaaagtggccctgggcgctggaagacaccagccact
gggcagcccgcgccagctgctgtcccccagcctggccgcacggacctgcccccaccccct
cctccgccccccacgcactataccagtgaatttgatggaatcccgatggatttgcctctc
ccaccccctcccgccagccagatgggacccccgtcggcgcaggtggctgctgccgaacgg
aagaagagggaggagcaccagcgctggtacgagaaggagaaggcccggctggaggaggag
cgggaacggaagcgccgggagcaggagaggaagctgggccagatgcgcacgcagcccctg
aaccctgctcccttttctcctgtgaccgtgcagccgcccacgaagcctgagaaaccagcc
acgctccagaggccccaagagacggtcattcgggagctgcagccccagcagcagccccgc
acgatcgagcgcagggacttgcagtacgtcacggttggcagggaggagctgtcctccggg
gacagcctgtctcccgacccctggaagcgggacgcccgggagaagctggagaagcagcag
cagatgcagatcgtggacatgctgagccgggagatccaggagctgcagggcaaggcggag
cgtagcgcggaggagagcgaccgcctgcgccggctgctgctggagtggcagttccagcgg
cggctgcaggaggcccggcaggaggaggaggaggaggaggacgacgaggtggacaccacg
ctgctcgcccggcgactggaggccgagcgcagagccagggacgaggaacgccggcggcag
cagcagctggaggagatgcggcaacgggaggcggaggagcgcgcccggcaggaggaccag
cggctgcggcaggaggaggagcggggcaagcgggacgctgaagaaaagaggagacaggaa
gaagggtactacagccgcctggaggccgagcggcgcagactgcacgaggaggccgagcgc
aggctgctggagcccgaggagccggggctgagcagacctccgcttccacggggctatgag
ccccccaccctgcccactgcggctggcgcccctccnnnnnnnnnnnnnnnnnnngcctcc
tacctgcaggcgcaggtcctctcccccgactccctgtacaccgccaagctcgttgcctac
accgaggaggaggaggactgcggccccgcaggaccagactcttccatgggatcctctggg
accctcgccggttcccgtgacgcgaatcgcgacccgagagagaaaccgtcgaaaagccaa
gacgcggattttcctggaagtgcaggagccccggagaacttgaccttcagagagcgccag
cgcctcttctcacaaggtcaagacgtgtccaataaagtgaaagcctctcgtaaattaaca
gaactggagaacgagctgaacaccaagtaa

DBGET integrated database retrieval system