KEGG   Miniopterus natalensis: 107537152
Entry
107537152         CDS       T05883                                 

Gene name
PRKG2
Definition
(RefSeq) cGMP-dependent protein kinase 2 isoform X1
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04730  Long-term depression
mna04740  Olfactory transduction
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107537152 (PRKG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107537152 (PRKG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107537152 (PRKG2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107537152 (PRKG2)
   04924 Renin secretion
    107537152 (PRKG2)
  09154 Digestive system
   04970 Salivary secretion
    107537152 (PRKG2)
  09156 Nervous system
   04730 Long-term depression
    107537152 (PRKG2)
  09157 Sensory system
   04740 Olfactory transduction
    107537152 (PRKG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537152 (PRKG2)
   04714 Thermogenesis
    107537152 (PRKG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107537152 (PRKG2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     107537152 (PRKG2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKG family
   107537152 (PRKG2)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like MPS2 RNase_Y_N Crescentin FeoB_N Adenine_glyco APH DUF16 Spc7 FAM76
Other DBs
NCBI-GeneID: 107537152
NCBI-ProteinID: XP_016068587
LinkDB
Position
Unknown
AA seq 762 aa
MGNGSVKPKHPKHPDGQSGNLTYNALRSKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHIQGGSLLQASPDGVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKESSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRVEVFQGEKLISCIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGTVKVTQSMEGHDQPQVIKTLQKGEYFGEKAL
ISEDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSHRNLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFVVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKR
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGTDQMMTYN
LILKGIEKMDFPRKITRKPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLSGFNWEGLK
ARNLPSPLRRELNGPTDHSYFDKYPPEKGVPPDELSGWDKDF
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacccaaacatcccaagcatccagacggccagtccgggaac
ctcacctacaatgcccttcgcagcaaggtgacagagctggagagagagctgaggaggaag
gatgctgagatccaggagcgggagtaccacttgaaggaactgcgggagcagctgtcgaag
cagacggtggccattgccgagctcacagaggagctgcagaacaagtgtatccagctgaac
aagctgcaggatgtggtgcacatccagggcggcagcctgctccaggcctctccggatggg
gtgcccctggaggtccaccggaagacctcgggacttgtctctctccacagcaggagggga
gcaaaggctggggtgtctgctgagccaacaacccgaacctacgacctcaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaggagtccagtgagaagaagctcattaca
gatgctcttaataaaaatcagtttttgaagagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatggaagaaactaccagcaagggagttacattattaagcaaggagaa
ccaggaaaccacatatttgtgctggcagagggccgagtagaggtgttccaaggggagaaa
ctgatctcatgcatccctatgtggaccacgtttggggaactagccattttatacaactgt
acgaggaccgcctctgtgaaagctattaccaatgttaaaacttgggcactagatcgagag
gtattccagaatataatgagaaggacagcgcaagctagagatgaacagtacagaaacttc
ctcagaagcgtatccttgctgaagaatttacctgaagacaaattaactaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacattatacgagagggcgaggaagga
agtaccttcttcattttagccaaaggaacggtcaaggtcacccagagtatggaaggccat
gatcagccacaagtgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgaagatgtcagatcagcaaacattatcgctgaggaaaatgatgttgcgtgcctg
gttatagatcgagaaacgttcaaccagacagttgggacttttgaagaactacaaaaatac
cttgaagggtatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcgaagagatcc
atgtctcaccggaatctgtcgaaagcgctctctctggagatgattcagctgaaggagaaa
gtggccagattttcctcttcatccccattccagaaccttgagattatcgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtaaaaaacgagaatgttgcttttgct
atgaagtgtataaggaagaaacacatagttgatactaagcaacaggagcatgtctactcg
gagaagaggatcctggaggagctgtgttcgcccttcgttgtgaaattgtatcgtactttc
aaggacaataagtatgtatacatgcttctggaagcctgcttaggtggggagctatggagc
atattaagggacagaggcagctttgatgaacccacctccaagttctgtgtggcttgtgtg
actgaagcatttgattacctgcatcgactaggtattatctacagagacctgaagccagaa
aacttaattctggatgctgagggctatctgaaattggttgactttggatttgctaagaga
ataggatctggacagaaaacatggacattctgtgggaccccagagtatgtagctcctgaa
gtcattctcaacaaaggccatgacttcagcgtggatttttggtccctgggaattctagtg
tatgagctcctgacgggcaacccacccttttctgggactgaccaaatgatgacctacaat
ttgattctcaaaggaattgaaaaaatggattttcccagaaaaataacaagaaaacctgag
gatttgattaggaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaagaat
ggaatcaatgacattaagaaacacaggtggttaagtggttttaattgggagggactgaaa
gcacggaaccttccatcacctttacgaagagagctcaatggacccaccgatcacagctac
tttgacaagtatcctcctgaaaagggagtgcctccagatgagctttcaggctgggataaa
gatttctga

KEGG   Miniopterus natalensis: 107543282
Entry
107543282         CDS       T05883                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04730  Long-term depression
mna04740  Olfactory transduction
mna04923  Regulation of lipolysis in adipocytes
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107543282 (PRKG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107543282 (PRKG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107543282 (PRKG1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107543282 (PRKG1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107543282 (PRKG1)
  09154 Digestive system
   04970 Salivary secretion
    107543282 (PRKG1)
  09156 Nervous system
   04730 Long-term depression
    107543282 (PRKG1)
  09157 Sensory system
   04740 Olfactory transduction
    107543282 (PRKG1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543282 (PRKG1)
   04714 Thermogenesis
    107543282 (PRKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107543282 (PRKG1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     107543282 (PRKG1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKG family
   107543282 (PRKG1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like Med4 Med28 APH Pkinase_C Tsc35 Spc7 PKcGMP_CC
Other DBs
NCBI-GeneID: 107543282
NCBI-ProteinID: XP_016076233
LinkDB
Position
Unknown
AA seq 686 aa
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSAGTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggcaccctgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccag
aagcttcagaacgagctggacaagtaccgctcggtgatccggccggccacccagcaggcg
cagaagcagagcgccggcaccttgcagggcgagccgcgcaccaagcgccaggcgatctcc
gcggagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccgcagtccaaggatctcataaaggaagccatccttgacaacgacttcatgaag
aacttggagctgtcgcagatccaggagattgtggattgtatgtacccggtggagtacggc
aaagacagctgcatcatcaaagaaggcgatgtggggtcactggtgtatgtcatggaagat
ggtaaggtggaagttacaaaagaaggcgtgaagctgtgcaccatgggcccagggaaggtg
ttcggggagttggcgattctttacaactgcacccggacggcgaccgtcaagactcttgta
aatgtgaagctctgggctattgatcgacaatgttttcagacaataatgatgaggaccgga
ctcatcaagcataccgaatatatggaatttttaaaaagtgttccaacattccagagcctt
cctgaagagatcctcagtaagcttgctgatgtccttgaagagacccactatgaaaatggg
gaatatatcatcaggcaaggtgcaagaggggacaccttctttatcatcagcaaaggaaag
gtaaacgtcactcgtgaagactccccaagcgaagacccagtctttcttaggactttagga
aaaggagattggtttggagagaaagccttgcagggggaggatgtgagaacagccaacgtg
attgccgcagaagctgtgacctgcctggtgatcgacagagactctttcaagcacttgatt
ggaggactggatgatgtttctaataaagcatatgaggatgcagaagccaaagcaaaatac
gaagctgaagctgctttcttcgccaacctgaagctgtctgatttcaacatcattgacacc
cttggagttggaggtttcggacgagtagagctggtccagttgaaaagtgaagaatccaaa
acctttgcaatgaagattctcaagaaacgccacattgtggatacaagacagcaggagcac
atccgctcggagaagcagatcatgcagggggctcactccgacttcatagtgagactatac
agaacatttaaggacagcaaatatttgtatatgttgatggaagcttgcctaggtggagag
ctctggaccattctcagggatagagggtcatttgaagattctacaaccagattttacaca
gcatgtgtggtagaagcttttgcctatctgcattccaaaggaatcatctacagggacctc
aagccagaaaatctcatcctggatcaccgaggttacgccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccggagtatgta
gccccagagatcatcctgaacaaaggccatgacatttcagccgactattggtcactggga
attctaatgtatgaactcctgactggcagcccacctttctcaggcccagatcctatgaaa
acctataacatcatattgagagggattgacatgatagaatttccaaagaagattgccaaa
aatgctgctaatttaattaaaaaactatgcagggacaacccatcagaaagattagggaat
ttgaaaaatggagtgaaagacattcaaaagcacaaatggtttgagggctttaattgggaa
ggcttaagaaaaggcaccttgacacctcctataataccaagtgttgcatcacccacagac
acaagcaattttgacagtttccctgaggacaatgacgaaccaccacctgatgacaactca
ggatgggacatagacttctaa

DBGET integrated database retrieval system