KEGG   Miniopterus natalensis: 107537180
Entry
107537180         CDS       T05883                                 

Gene name
AMY2B
Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00500  Starch and sucrose metabolism
mna01100  Metabolic pathways
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107537180 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107537180 (AMY2B)
   04972 Pancreatic secretion
    107537180 (AMY2B)
   04973 Carbohydrate digestion and absorption
    107537180 (AMY2B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107537180 (AMY2B)
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Other DBs
NCBI-GeneID: 107537180
NCBI-ProteinID: XP_016068613
LinkDB
Position
Unknown
AA seq 515 aa
MKFLLLLSALGLCWAQWDPNTRPGRTVIVHLFEWRWADIALECERYLAPRGFGGVQISPP
NENVIINDPLRPWWERYQPISYKLCTRSGNEDEFRDMVKRCNDVGVHIYVDAVINHMCGN
GVSAGTRSTCGSFFNPGARDFPSVPYSAWDFNDHKCRTASGDIENYNDAYQVRDCRLVGL
LDLALEKDYVRSTVAEYMNRLIDIGVAGFRIDAAKHMWPGDMKAVLDKLRHLNTTWFPAE
TKPFIYQEVIDLGGESIKSSEYFDNGFVTEFKYGAKLGTVLRKWSGERMAYLKNWGEGWG
FMPSNRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMGVAFMLAHPYGFTRVMSSFHWP
RYFVNGKDINDWMGPPNDDGVIKEVTINPDTTCGNGWVCEHRWRQIRNMVTFRNVADGQP
FANWWDNGSNQVAFGRGNKGFIVFNNDEWPLSAYLQTGLPAGTYCDVISGDKIDNKCTGM
KIYVSADGNAHFSISNSAEDPFIAIHEESKLENLH
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaagttccttctgctgctctcagcccttgggctctgctgggcccagtgggaccccaac
accaggccggggcgcacggtcatcgtgcacctgtttgagtggcgctgggccgacatcgct
ctcgagtgcgagcgatacttggctcccagaggattcggaggggtccagatctctccaccc
aacgaaaacgttataattaatgaccctttaagaccttggtgggaaagataccaaccgatt
agctacaagttatgtacaagatcaggaaatgaagatgaattcagagacatggtgaagaga
tgcaacgacgtgggcgttcacatctacgtggacgccgtcatcaaccacatgtgtgggaac
ggcgtgagcgcgggaaccaggagcacctgcgggagcttcttcaacccgggagccagggac
tttccctccgtcccctactccgcttgggactttaacgaccataaatgcagaactgccagt
ggcgacattgagaactacaacgatgcttatcaggtccgagactgtcgcctggtcgggctg
cttgacctggccctagagaaggactacgtgcggtccacggtggccgagtacatgaaccgc
ctcatcgacatcggcgtggcaggcttccgaatcgacgctgccaagcacatgtggcccgga
gacatgaaggccgtcctggataagctgcgccatctgaatacaacctggttcccagcagaa
acgaagcctttcatttaccaggaggtaattgatctgggcggtgagtccattaaaagcagt
gaatactttgacaacggctttgtgacggagttcaagtacggagcaaagctgggcacagtg
ctgcgcaagtggagcggagagaggatggcctacctcaagaactggggagaaggctggggc
ttcatgccttccaacagagcgctcgtctttgtggacaaccatgacaaccagcggggccac
ggcgcggggggcgcgtccatcctcacgttctgggactcgagactctacaaaatgggagta
gcatttatgctcgcccatccttacgggttcacgcgcgtcatgtcaagcttccattggcca
aggtattttgtgaatggaaaagatattaacgactggatggggccaccgaacgatgatggg
gtgattaaagaggtcaccatcaacccggacaccacctgtggcaacggctgggtctgtgag
caccggtggcgccagataaggaacatggtcacgttccgcaacgtggcggacggccagccc
ttcgccaactggtgggataacggcagcaaccaggtcgccttcgggagagggaacaagggc
ttcatcgtcttcaacaatgacgagtggccattaagtgcatatttgcaaactggtcttcct
gctggcacatactgcgatgtgatttccggagataaaattgataacaaatgtacaggaatg
aagatctacgtctctgctgatggcaatgctcacttttctatcagcaactctgccgaagat
ccgtttatcgctattcatgaggagtctaaattagaaaacttgcattaa

DBGET integrated database retrieval system