KEGG   Miniopterus natalensis: 107537230
Entry
107537230         CDS       T05883                                 

Gene name
GNRHR
Definition
(RefSeq) gonadotropin-releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537230 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107537230 (GNRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107537230 (GNRHR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    107537230 (GNRHR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107537230
NCBI-ProteinID: XP_016068698
LinkDB
Position
Unknown
AA seq 327 aa
MANSVSPEQNQNHCSSINSSSPLLQGTLPTLTLSGKIRVTVTFFLFLLSTTFNASFLLKL
KKWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYGGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLAASSSKLGPSLTGLAWLLSSLFAGPQLYIFRMI
HLADGSGQSGGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTRI
LQQDPHKLRLNRSKDNIPSARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLDRVS
DPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcaaacagtgtttctcctgaacagaatcagaatcactgctcgtccatcaacagcagc
agcccgctgctgcagggcaccctccccacactgaccttatctggaaagatccgggtgaca
gtcactttcttcctttttctactctccacgactttcaacgcttctttcttgctgaaactt
aagaagtggactcagaagaaagagaaagggaaaaagctctccagaatgaaggtgctttta
aaacatctgactttagccaacctgttggagactctgattgtcatgccactggacgggatg
tggaacatcacagtccagtggtatgggggagagctcctctgcaaagtcctcagctacctg
aagcttttctccatgtacgccccggccttcatgatggtagtgatcagcctggaccgctcc
ctggccatcacgagacccctcgctgcgagcagcagcaagctgggaccgtccttgactggc
ttggcatggctcctcagcagcctctttgctggaccacagttatatatcttcagaatgatt
catttagccgatggctctggacagtcgggaggcttctctcaatgtgtaacacactgcagt
tttccacagtggtggcaccaagccttttacaacttcttcaccttcagctgcctcttcatc
attcctcttctcatcatgttgatctgcaacgcaaaaatcatcttcaccctcactaggatc
cttcagcaggatccccacaaactacgactgaatcgatccaaggataacataccgagcgct
cggctgcggaccctaaagatgacggtcgcgtttgccacctcgtttaccgtctgctggact
ccctactacgtcctagggatctggtattggtttgaccctgaaatgctggacagggtgtca
gacccagtgaatcacttcttctttctctttgcttttttaaatccatgcttcgatccactt
atatatggctatttctctctgtga

DBGET integrated database retrieval system