KEGG   Miniopterus natalensis: 107537334Help
Entry
107537334         CDS       T05883                                 

Gene name
LEP
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04152  AMPK signaling pathway
mna04630  Jak-STAT signaling pathway
mna04920  Adipocytokine signaling pathway
mna04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    107537334 (LEP)
   04152 AMPK signaling pathway
    107537334 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537334 (LEP)
   04060 Cytokine-cytokine receptor interaction
    107537334 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107537334 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    107537334 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107537334 (LEP)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  CSF and other factors
   107537334 (LEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Leptin
Motif
Other DBs
NCBI-GeneID: 107537334
NCBI-ProteinID: XP_016068814
LinkDB All DBs
Position
Unknown
AA seq 167 aa AA seqDB search
MRCGLLCQFLWLWPYLFCTEAAPIQKVQDDTKTLIKTIVTRINDISHTRSVSSKQRVTGL
DFIPGLYPVLSLSKMDQTLAIYQQILTSLPSGNVLQISNDLENLRDLLRLLASSNSCPFP
RTRGLKTLEGLGDVLEASLYSTEVVVLSRLQGSLQDMLQQLDFSPGC
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcggactcctgtgccaattcctgtggctttggccctatctgttctgtacagaa
gctgcgcccatccaaaaagtccaggatgacaccaaaaccctcatcaagacgattgtcacc
agaatcaatgacatttcacacacgcggtcagtctcctccaaacagagggtcaccggtttg
gacttcattcctgggctctaccctgtcctgagtttgtccaagatggaccagacattggcg
atttaccaacagatcctcaccagcctgccttctggaaatgtgctccaaatatctaatgac
ctggagaacctccgggaccttctccgcctgctggcctcctccaatagctgccccttcccc
cggaccaggggtctgaagaccttggagggcctgggtgatgtcctggaagcttcactctat
tccacagaggtggtggtcctgagcaggctgcaggggtctctgcaggacatgctacagcag
ctggacttcagccctgggtgctga

DBGET integrated database retrieval system