KEGG   Miniopterus natalensis: 107537599
Entry
107537599         CDS       T05883                                 

Gene name
RAC1
Definition
(RefSeq) LOW QUALITY PROTEIN: ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04145  Phagosome
mna04151  PI3K-Akt signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04972  Pancreatic secretion
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05416  Viral myocarditis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107537599 (RAC1)
   04014 Ras signaling pathway
    107537599 (RAC1)
   04015 Rap1 signaling pathway
    107537599 (RAC1)
   04310 Wnt signaling pathway
    107537599 (RAC1)
   04370 VEGF signaling pathway
    107537599 (RAC1)
   04071 Sphingolipid signaling pathway
    107537599 (RAC1)
   04024 cAMP signaling pathway
    107537599 (RAC1)
   04151 PI3K-Akt signaling pathway
    107537599 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107537599 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107537599 (RAC1)
   04520 Adherens junction
    107537599 (RAC1)
   04530 Tight junction
    107537599 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107537599 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107537599 (RAC1)
   04620 Toll-like receptor signaling pathway
    107537599 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    107537599 (RAC1)
   04662 B cell receptor signaling pathway
    107537599 (RAC1)
   04664 Fc epsilon RI signaling pathway
    107537599 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    107537599 (RAC1)
   04670 Leukocyte transendothelial migration
    107537599 (RAC1)
   04062 Chemokine signaling pathway
    107537599 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    107537599 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107537599 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    107537599 (RAC1)
   04380 Osteoclast differentiation
    107537599 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537599 (RAC1)
   05205 Proteoglycans in cancer
    107537599 (RAC1)
   05203 Viral carcinogenesis
    107537599 (RAC1)
   05231 Choline metabolism in cancer
    107537599 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107537599 (RAC1)
   05212 Pancreatic cancer
    107537599 (RAC1)
   05211 Renal cell carcinoma
    107537599 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537599 (RAC1)
   05020 Prion disease
    107537599 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    107537599 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537599 (RAC1)
   05416 Viral myocarditis
    107537599 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107537599 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107537599 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107537599 (RAC1)
   05135 Yersinia infection
    107537599 (RAC1)
   05100 Bacterial invasion of epithelial cells
    107537599 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107537599 (RAC1)
   05163 Human cytomegalovirus infection
    107537599 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537599 (RAC1)
   05169 Epstein-Barr virus infection
    107537599 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107537599 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107537599 (RAC1)
   04031 GTP-binding proteins [BR:mna04031]
    107537599 (RAC1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107537599 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107537599 (RAC1)
  Macropinocytosis
   Ras GTPases
    107537599 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107537599 (RAC1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107537599 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   107537599 (RAC1)
  Exosomal proteins of colorectal cancer cells
   107537599 (RAC1)
  Exosomal proteins of bladder cancer cells
   107537599 (RAC1)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107537599 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107537599
NCBI-ProteinID: XP_016069127
LinkDB
Position
Unknown
AA seq 215 aa
MVTKQFTPFXSLSLSRAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLW
DTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKW
YPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLEC
SALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtaaccaagcaatttacacctttcntctctctctctctctctagagctgtaggtaaa
acttgcctactgatcagttatacaaccaatgcatttcctggagaatatatccccactgtc
tttgacaactattctgccaatgttatggtagatggaaaaccggtgaacctgggcttgtgg
gatactgctggacaagaagattacgacagactacgtcctctctcctatccgcagacagtt
ggagaaacgtatggtaaggatataacctccaggggcaaagacaagccgattgccgatgta
ttcttaatttgcttttctcttgtgagtcctgcgtcatttgaaaatgttcgtgcaaagtgg
tatcctgaagtgcgacaccattgtcccaacactcccatcatcctggtggggactaagctt
gaccttagggatgataaagacactattgagaaactgaaggagaagaagctgacacccatc
acctacccgcagggcttagccatggccaaggagatcggtgctgtaaaatacctggagtgc
tcggcgctcacacagcgcggcctcaagacagtgtttgatgaagctattcgagccgttctc
tgcccgcctcccgtcaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Miniopterus natalensis: 107539040
Entry
107539040         CDS       T05883                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04650  Natural killer cell mediated cytotoxicity
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05416  Viral myocarditis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107539040 (RAC3)
   04014 Ras signaling pathway
    107539040 (RAC3)
   04015 Rap1 signaling pathway
    107539040 (RAC3)
   04310 Wnt signaling pathway
    107539040 (RAC3)
   04370 VEGF signaling pathway
    107539040 (RAC3)
   04071 Sphingolipid signaling pathway
    107539040 (RAC3)
   04024 cAMP signaling pathway
    107539040 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107539040 (RAC3)
   04520 Adherens junction
    107539040 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107539040 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107539040 (RAC3)
   04662 B cell receptor signaling pathway
    107539040 (RAC3)
   04664 Fc epsilon RI signaling pathway
    107539040 (RAC3)
   04062 Chemokine signaling pathway
    107539040 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    107539040 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539040 (RAC3)
   05231 Choline metabolism in cancer
    107539040 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107539040 (RAC3)
   05212 Pancreatic cancer
    107539040 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107539040 (RAC3)
   05416 Viral myocarditis
    107539040 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107539040 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107539040 (RAC3)
   05163 Human cytomegalovirus infection
    107539040 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107539040 (RAC3)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107539040 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107539040
NCBI-ProteinID: XP_016070901
LinkDB
Position
Unknown
AA seq 167 aa
MEGNGSRVQLPQPPAWCFAATCYNPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLV
SPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTVERLRDKKLAPITYPQGLAM
AREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaaggaaatgggagcagagtccagctcccgcagccgcccgcctggtgcttcgcagcc
acctgttacaatccggtcaacctggggctgtgggacacggccgggcaggaagactacgac
cgacttcggccactgtcctacccccaaaccgatgtcttcctgatctgcttctccttggtg
agcccagcctcctttgagaatgtccgagccaagtggtacccggaggtgcggcaccattgc
ccccacacgcccatcctcctggtgggcaccaagctggacctccgggacgacaaagacacc
gtcgagcggctgagggacaagaagctggcacccatcacataccctcagggcctggccatg
gcccgggagatcggctcagtcaagtacctggagtgctcggctctgactcagcggggtctg
aagacagtgtttgacgaggccatcagggcagtgctctgcccacccccggtgaaaaagcct
gggaaaaaatgcacagtcttctag

KEGG   Miniopterus natalensis: 107545262
Entry
107545262         CDS       T05883                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05020  Prion disease
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
mna05416  Viral myocarditis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545262 (RAC2)
   04014 Ras signaling pathway
    107545262 (RAC2)
   04015 Rap1 signaling pathway
    107545262 (RAC2)
   04310 Wnt signaling pathway
    107545262 (RAC2)
   04370 VEGF signaling pathway
    107545262 (RAC2)
   04071 Sphingolipid signaling pathway
    107545262 (RAC2)
   04024 cAMP signaling pathway
    107545262 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107545262 (RAC2)
   04520 Adherens junction
    107545262 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107545262 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545262 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    107545262 (RAC2)
   04662 B cell receptor signaling pathway
    107545262 (RAC2)
   04664 Fc epsilon RI signaling pathway
    107545262 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    107545262 (RAC2)
   04670 Leukocyte transendothelial migration
    107545262 (RAC2)
   04062 Chemokine signaling pathway
    107545262 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    107545262 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545262 (RAC2)
   05231 Choline metabolism in cancer
    107545262 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107545262 (RAC2)
   05212 Pancreatic cancer
    107545262 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    107545262 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545262 (RAC2)
   05416 Viral myocarditis
    107545262 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107545262 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545262 (RAC2)
   05163 Human cytomegalovirus infection
    107545262 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107545262 (RAC2)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107545262 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107545262
NCBI-ProteinID: XP_016078790
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtggtggtgggagatggagccgtgggtaagacctgccttctc
atcagctacaccaccaatgccttcccaggagagtacatccccaccgtgtttgacaactat
tcagctaacgtgatggtggacagcaagccagtgaacctggggctgtgggacacagccggg
caggaggactatgaccggctccggccactgtcctacccgcagacggacgtcttcctcatc
tgcttctccctcgttagccctgcctcctatgagaatgtccgtgccaagtggtttcccgag
gtccggcaccactgccccagcacacccatcatcctggtgggcaccaagctggatctgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaaactcgcgcctatcacctaccca
cagggcttggcactggccaaagagattgattcagtgaaatacctggagtgctcggccctc
acccagcggggcctgaagaccgtctttgacgaggcaatccgggccgtcctctgtccccag
cccacgcggccgcagaagcgcccctgcagcatcctctag

DBGET integrated database retrieval system