KEGG   Miniopterus natalensis: 107537600
Entry
107537600         CDS       T05883                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04145  Phagosome
mna04210  Apoptosis
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04810  Regulation of actin cytoskeleton
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04971  Gastric acid secretion
mna05014  Amyotrophic lateral sclerosis
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05164  Influenza A
mna05205  Proteoglycans in cancer
mna05225  Hepatocellular carcinoma
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107537600 (ACTB)
   04390 Hippo signaling pathway
    107537600 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107537600 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    107537600 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107537600 (ACTB)
   04520 Adherens junction
    107537600 (ACTB)
   04530 Tight junction
    107537600 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107537600 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107537600 (ACTB)
   04613 Neutrophil extracellular trap formation
    107537600 (ACTB)
   04670 Leukocyte transendothelial migration
    107537600 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107537600 (ACTB)
   04919 Thyroid hormone signaling pathway
    107537600 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    107537600 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    107537600 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107537600 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537600 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537600 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537600 (ACTB)
   05410 Hypertrophic cardiomyopathy
    107537600 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107537600 (ACTB)
   05414 Dilated cardiomyopathy
    107537600 (ACTB)
   05416 Viral myocarditis
    107537600 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107537600 (ACTB)
   05135 Yersinia infection
    107537600 (ACTB)
   05100 Bacterial invasion of epithelial cells
    107537600 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    107537600 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107537600 (ACTB)
   03019 Messenger RNA biogenesis [BR:mna03019]
    107537600 (ACTB)
   03036 Chromosome and associated proteins [BR:mna03036]
    107537600 (ACTB)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107537600 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107537600 (ACTB)
   04147 Exosome [BR:mna04147]
    107537600 (ACTB)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107537600 (ACTB)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107537600 (ACTB)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     107537600 (ACTB)
    NuA4 complex
     107537600 (ACTB)
  Chromatin remodeling factors
   BAF complex
    107537600 (ACTB)
   PBAF complex
    107537600 (ACTB)
   SWR1 complex
    107537600 (ACTB)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    107537600 (ACTB)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107537600 (ACTB)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107537600 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107537600
NCBI-ProteinID: XP_016069128
LinkDB
Position
Unknown
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgctcgtggtcgacaacggctccggcatgtgcaaagccggt
ttcgcgggtgacgatgcccccagggccgtcttcccctccatcgtaggtcgtccccggcat
cagggtgtgatggtgggcatgggccagaaggactcctacgtgggtgatgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcacggcattgtcaccaactgggac
gatatggagaagatctggcatcacaccttttacaatgagctgcgtgtggcccccgaggag
caccctgtcctgctcactgaggcccccctgaaccccaaggccaatcgtgagaagatgacc
cagataatgttcgagaccttcaacacccccgccatgtatgtggccatccaggctgtgctg
tccttgtacgcctctggccgtaccactggcattgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgagggatacgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatccttacggagcgtggctacagcttc
accaccacagctgagcgggaaattgtgcgtgacatcaaggaaaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccactgcagcctccagctcctccctggagaagagctac
gagctgcccgatgggcaggtcatcactattggcaacgagcggttccgctgccctgaggcc
cttttccagccctccttcctgggtatggaatcctgtggcatccacgaaactacctttaac
tccatcatgaagtgtgatgttgacatccgtaaggacctctatgccaacacagtgctgtcc
ggtgggaccaccatgtacccaggcattgccgacaggatgcagaaggaaatcactgccctg
gctcccagcacaatgaagatcaagatcattgcgccccctgagcgcaagtactctgtgtgg
atcggcggctccatcctagcctccctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Miniopterus natalensis: 107539076
Entry
107539076         CDS       T05883                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04145  Phagosome
mna04210  Apoptosis
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04810  Regulation of actin cytoskeleton
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04971  Gastric acid secretion
mna05014  Amyotrophic lateral sclerosis
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05164  Influenza A
mna05205  Proteoglycans in cancer
mna05225  Hepatocellular carcinoma
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107539076 (ACTG1)
   04390 Hippo signaling pathway
    107539076 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107539076 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    107539076 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107539076 (ACTG1)
   04520 Adherens junction
    107539076 (ACTG1)
   04530 Tight junction
    107539076 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107539076 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107539076 (ACTG1)
   04613 Neutrophil extracellular trap formation
    107539076 (ACTG1)
   04670 Leukocyte transendothelial migration
    107539076 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107539076 (ACTG1)
   04919 Thyroid hormone signaling pathway
    107539076 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    107539076 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107539076 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107539076 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107539076 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107539076 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107539076 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    107539076 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107539076 (ACTG1)
   05414 Dilated cardiomyopathy
    107539076 (ACTG1)
   05416 Viral myocarditis
    107539076 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107539076 (ACTG1)
   05135 Yersinia infection
    107539076 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    107539076 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    107539076 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107539076 (ACTG1)
   03019 Messenger RNA biogenesis [BR:mna03019]
    107539076 (ACTG1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107539076 (ACTG1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107539076 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107539076 (ACTG1)
   04147 Exosome [BR:mna04147]
    107539076 (ACTG1)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107539076 (ACTG1)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107539076 (ACTG1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     107539076 (ACTG1)
    NuA4 complex
     107539076 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    107539076 (ACTG1)
   PBAF complex
    107539076 (ACTG1)
   SWR1 complex
    107539076 (ACTG1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    107539076 (ACTG1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107539076 (ACTG1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107539076 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107539076
NCBI-ProteinID: XP_016070943
LinkDB
Position
Unknown
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaggagatcgccgcgctggtcatcgacaatggctccggcatgtgcaaagcgggc
tttgccggggacgacgccccccgcgccgtgttcccgtccatcgtcgggcgcccccggcac
cagggcgtcatggtgggcatggggcagaaggactcctacgtgggtgacgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccattgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag
cacccggtgctgctgaccgaggcccctctgaaccccaaggccaaccgtgagaagatgact
cagatcatgttcgagaccttcaacacgccggccatgtacgtggccatccaggcggtgctg
tccctgtacgcctccggccgcaccactggcattgtcatggactctggggacggggtcacc
cacactgtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc
accaccacggccgagcgggagatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggccgcgtcgtcgtcctcgctggagaagagctac
gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccctccttcctcggaatggagtcgtgcggcatccacgagaccaccttcaac
tccatcatgaagtgcgacgtggacatccggaaggacctctacgccaacacggtgctgtcg
ggcgggaccaccatgtacccgggcattgccgacaggatgcagaaggagatcacagccctg
gcgcccagcaccatgaagatcaagatcatcgccccgcctgagcgcaagtactcggtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gaatacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system