KEGG   Miniopterus natalensis: 107537702
Entry
107537702         CDS       T05883                                 

Gene name
BID
Definition
(RefSeq) LOW QUALITY PROTEIN: BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04071  Sphingolipid signaling pathway
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04650  Natural killer cell mediated cytotoxicity
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107537702 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107537702 (BID)
   04215 Apoptosis - multiple species
    107537702 (BID)
   04217 Necroptosis
    107537702 (BID)
   04115 p53 signaling pathway
    107537702 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107537702 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537702 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107537702 (BID)
   05014 Amyotrophic lateral sclerosis
    107537702 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    107537702 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107537702 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107537702 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107537702 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107537702 (BID)
   05161 Hepatitis B
    107537702 (BID)
   05160 Hepatitis C
    107537702 (BID)
   05164 Influenza A
    107537702 (BID)
   05162 Measles
    107537702 (BID)
   05168 Herpes simplex virus 1 infection
    107537702 (BID)
   05163 Human cytomegalovirus infection
    107537702 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537702 (BID)
   05169 Epstein-Barr virus infection
    107537702 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107537702 (BID)
SSDB
Motif
Pfam: BID DUF5631
Other DBs
NCBI-GeneID: 107537702
NCBI-ProteinID: XP_016069263
LinkDB
Position
Unknown
AA seq 263 aa
MGVSPAQKIFHGGPGQFLQPISLRAGERGPCCSVVHLRCREALAFWGLGEALSSLPHMNL
GFGCRLWGFSSSRCRGRGVGLGLLPWTPVSRNPVKPPAACAMDPKVSNGSGIQDECITDL
LVFGFLQNCSNYNFHKELQVLGHDLPVPVCLGESHDDELQTDGSRYSHFVLQSQETDSES
QEEIIQNIARQLAQIGDRMDRSVPPRLVNHLAIQFMNGNLSEEDRRECLAAVLEQVMQTY
PKDMEEEKTMLLLTMLLAKKEMD
NT seq 792 nt   +upstreamnt  +downstreamnt
atgggggtcagtcctgcacagaaaatcttccatggtggtcctggccagttcttgcagcca
atcagcctgagggcgggagagcgggggccgtgctgctctgtggttcatttacgttgccga
gaggccctggccttttgggggttgggagaggctttgtcctctctgccccacatgaacctc
gggtttggctgtcgtctgtggggcttcagctcgtcgcgttgcagggggcgcggagtggga
ctggggctgctgccgtggacacctgtgagccggaatccagtcaagcctccagctgcctgt
gccatggatcccaaggtcagcaatggttcaggaatccaggatgagtgcatcacagatttg
ctggtgtttggcttcctccaaaactgctccaactacaatttccacaaagagctgcaggtg
ttgggccatgacctgcctgtgccagtttgcctgggggaaagccatgacgatgaactacag
acagatggcagtcggtacagccactttgtcctgcagagccaggagacagattctgagagt
caagaggaaatcatccagaatatcgccaggcaacttgcccagataggggacaggatggac
cgcagcgtccccccgagactggtgaatcacctggcaatacagtttatgaatgggaacctg
tcagaggaagacagaagggagtgccttgctgctgtcctggagcaggtcatgcagacttat
cctaaagacatggaggaggagaagaccatgctgctgttgaccatgctgttggccaaaaag
gagatggactga

DBGET integrated database retrieval system