KEGG   Miniopterus natalensis: 107537801
Entry
107537801         CDS       T05883                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1 isoform X1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04115  p53 signaling pathway
mna04218  Cellular senescence
mna04914  Progesterone-mediated oocyte maturation
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107537801 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107537801 (CCNB1)
   04114 Oocyte meiosis
    107537801 (CCNB1)
   04115 p53 signaling pathway
    107537801 (CCNB1)
   04218 Cellular senescence
    107537801 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107537801 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107537801 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107537801 (CCNB1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107537801 (CCNB1)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    107537801 (CCNB1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107537801 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 107537801
NCBI-ProteinID: XP_016069402
LinkDB
Position
Unknown
AA seq 433 aa
MALRVTRNTKINAENKAKISIAGAKRVPVATAAASKAGLRPRTALGDIANNVSEQPQAKL
PLKKEAKTLAAGKVIAKKLPKPLEKALEPIPVPVPVPVPDPAPEPEPEPVKEEKLSPEPI
LVDNPSPSPMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYTYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNSVP
KKMLQLVGVTAMFVASKYEEMYPPEIGDFAFVTDNTYTKLQIRQMEMKILRALNFCLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPVLQHYLSYTEDSLLVVMQHLAKNIVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNS
ALVQDLAKAVAKV
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgctgcgggtcaccaggaacacgaaaattaatgctgaaaataaggcgaagatcagt
atagcaggcgcaaagcgcgtgcctgtggccactgctgcagcctccaaggccggactgcgg
ccaagaacagcgcttggagacatcgctaacaatgtcagtgaacagccacaggccaaattg
cctctgaaaaaggaggcaaaaactttagctgctggaaaagttattgctaaaaagctacca
aaacctctggaaaaggcactggagcccatacctgtgcctgtgcctgtgcctgtgcctgac
ccggcaccggagccagaacctgagcctgtgaaagaagaaaaactttctcctgagcctatt
ttggttgataatccctctccaagcccaatggaaacgtctggctgtgcccctgccgaagaa
tatctgtgtcaggctttctctgatgtaattcttgcagtgaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagacatctatacttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaataccttctgggtcgtgaagtcactggaaac
atgagagccatcctaattgattggctggtgcaggttcaaatgaaatttaggttactgcag
gagaccatgtacatgactgtttccattattgaccggttcatgcagaataattctgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttgttgccagcaaatatgaagaa
atgtaccctccagaaatcggtgactttgcctttgtgactgacaacacttacactaagctc
caaatcagacagatggaaatgaagattctgagagctttaaatttttgtctgggtcgccct
ctacccctgcatttccttcggagagcatctaagattggagaggttgatgtggagcaacat
actttggccaaatacctgatggaactaactatgttagactatgatatggtgcactttcct
ccttctcagattgcagcaggagctttttgtttagcgctgaaaattctcgataatggtgaa
tggacaccagttctacagcattacctgtcatacactgaagattcccttcttgttgtcatg
caacacctcgctaagaacatagtcatggtgaatcgtgggcttacaaagcacatgactatc
aagaacaagtatgccacgtctaagcatgctaaaatcagcactctagcacagctgaattca
gcactagttcaagatttagccaaggctgtggcgaaggtgtaa

DBGET integrated database retrieval system