KEGG   Miniopterus natalensis: 107537943
Entry
107537943         CDS       T05883                                 

Gene name
PBX1
Definition
(RefSeq) pre-B-cell leukemia transcription factor 1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107537943 (PBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107537943 (PBX1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107537943 (PBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107537943 (PBX1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    107537943 (PBX1)
SSDB
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3
Other DBs
NCBI-GeneID: 107537943
NCBI-ProteinID: XP_016069555
LinkDB
Position
Unknown
AA seq 307 aa
MFCPSDVDLERCELSAACPNSWPAAVSLLLSSGWRTPLFVAGREGPWACNEFTTHVMNLL
REQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQ
ATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEAN
IYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQV
GANVQSQVDTLRHVISQTGGYSDGLAAGQMYSPQGISANGGWQDATTPSSVTSPTEGPGS
VHSDTSN
NT seq 924 nt   +upstreamnt  +downstreamnt
atgttctgtccgtcggacgtggacttggaacgctgtgagctgtcggctgcgtgtccgaac
agctggccagcagctgtctccctgctgctcagcagtgggtggaggactccactgtttgtg
gccgggcgggaggggccctgggcctgcaacgagttcaccacccatgtgatgaacctgctg
cgcgagcagagccggacccggcccatctcaccaaaggagatcgagcggatggtcagcatc
atccaccgcaagttcagctccatccagatgcagctcaagcagagcacctgtgaggccgtc
atgatcctgcgctcccggttcctggacgcgaggcggaagagacggaatttcaacaagcag
gcgacggaaatcctgaatgagtatttctattcccatctcagcaacccttaccccagtgag
gaagccaaagaggagttagccaagaagtgcggcatcaccgtgtcccaggtatcaaactgg
tttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagaggaagccaat
atttatgctgccaaaacggctgtcactgccaccaatgtgtcagcccacggaagccaagct
aactcaccctcaactcccaactcggctggttcttccagctcttttaacatgtcaaactct
ggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggggcccaggtt
ggagccaacgtgcagtcacaggtggatacccttcgccatgttatcagccagaccggagga
tacagtgatggactcgcagccggtcagatgtacagtccgcagggcatcagcgctaatgga
ggttggcaggatgcgactaccccctcatcagtgacgtcccccacagaaggccctggcagt
gttcactccgacacctccaactga

DBGET integrated database retrieval system