KEGG   Miniopterus natalensis: 107538002
Entry
107538002         CDS       T05883                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107538002 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107538002 (HBEGF)
   04915 Estrogen signaling pathway
    107538002 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    107538002 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107538002 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    107538002 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107538002 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107538002 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107538002 (HBEGF)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107538002 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 107538002
NCBI-ProteinID: XP_016069613
LinkDB
Position
Unknown
AA seq 212 aa
MKLLPSVVLKLFLAAVAVLSALVTGESLERLRRGLVGGTSNLGSPTESTDQLLPPGGGRG
REVLDLEEADLDLLRAPFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIH
GDCKYVKAIRAPSCICHLGYHGERCHGLSLPVENPLSTYDHTTILAVVAVVLSSVCLLVI
VGLLMFRNQLGTATSEKTQADHRLRRGEGLHN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctagctgcagtcgcagtgctctca
gccttggtgactggagagagcctggagcggcttcgaagagggctggtgggtggaaccagc
aacctgggatctcccactgaatcgacggaccagctgctgcccccgggaggcggccgaggc
cgtgaagtcctggacttagaggaggccgacctggacctcctcagagctcctttctcctcc
aagccacaagctctggccacacccagcaaggaggaacgtgggaaaagaaagaagaaaggc
aaggggttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccac
ggagactgcaaatatgtgaaggcgatccgggctccatcctgcatctgccacctgggttac
catggagagaggtgtcatgggctgagcctcccggtggaaaatcccttatctacttatgac
cacacaaccatcctggctgtggtggccgtggtgctgtcgtctgtctgtctgctcgtcatt
gtggggcttctcatgttcaggaatcagctggggactgctacctctgagaagacacaagct
gatcacagactccgcagaggggaaggacttcacaactag

DBGET integrated database retrieval system