KEGG   Miniopterus natalensis: 107538021
Entry
107538021         CDS       T05883                                 

Definition
(RefSeq) calreticulin-like
  KO
K08057  calreticulin
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04145  Phagosome
mna04612  Antigen processing and presentation
mna05142  Chagas disease
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538021
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107538021
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107538021
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538021
   05170 Human immunodeficiency virus 1 infection
    107538021
   05168 Herpes simplex virus 1 infection
    107538021
   05163 Human cytomegalovirus infection
    107538021
   05169 Epstein-Barr virus infection
    107538021
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107538021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107538021
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107538021
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   107538021
Lectins [BR:mna04091]
 Calnexin / calreticulin
  107538021
SSDB
Motif
Pfam: Calreticulin DUF1682
Other DBs
NCBI-GeneID: 107538021
NCBI-ProteinID: XP_016069650
LinkDB
Position
Unknown
AA seq 402 aa
GWQKRWVESKHRPDYGKFQLTAGKFYGDKEKDKGLQTSEDAKFYALSTRFKPFSNENETL
VVQFSVKHEQGIDCGGGYVKLFPDTLNQEDMHSESEYYVMFGPDICGFDNNKVQVILHYQ
GKYHENEKTIKCRINKDTHLYTLIIRPNATYGVKIDNKQVAAGNLEDDWNFLPPRKIKDP
YARKPRKWDERLQIEDPEDKKPEDWEDFEYIPDPDAKKPDDWDEAMDGQWEGPLIPNLKY
KGQWKPRIIDNPNYQGEWIHPEIDNPKYKPDPTICHYYNISVLGLDLWQVKSGSIFDNFL
LTNDEEFAEEVGNKTWGLRKDVERQWRELFEEMEKRKQEEEAEERRGKEEEREGDIWGIG
EEGSEEDFAEEPGNDRQMEDADAERAFLDKNKEVRVDQTDEL
NT seq 1211 nt   +upstreamnt  +downstreamnt
atggatggcaaaaacgatgggtggaatctaaacataggccggattatggtaaatttcagc
tcactgcgggaaaattttatggagacaaagaaaaagataaaggtctccagaccagtgaag
atgccaagttttatgccctctcaaccaggtttaagccattcagcaatgagaacgagacct
tggtggttcagttttcagtaaaacacgagcaaggcatcgattgtggtggcgggtacgtga
aactctttcctgacaccctgaaccaggaggatatgcattcggaatccgagtattacgtca
tgtttggccctgacatctgtggctttgacaacaacaaagtacaggtcatccttcattacc
aagggaaataccatgagaacgagaagaccatcaagtgcaggatcaacaaagacactcacc
tatacactctgatcattcgtcccaatgctacttatggggttaaaattgacaataagcaag
tagcagcagggaatctggaggatgactggaacttcttgcctcccagaaagataaaagacc
cctatgcccggaaaccaaggaaatgggatgaacgtctgcaaatagaggatcctgaagata
agaaacctgaggactgggaggactttgagtacatcccagacccagacgccaagaagccag
atgactgggatgaggcgatggatggacagtgggaagggccgttgataccaaacctgaagt
ataagggacaatggaaacctcgaatcattgacaatcccaattaccagggagagtggattc
atccagaaatagacaaccctaaatataagcctgaccctaccatttgtcactattataaca
tcagtgttcttggcctggacctttggcaggtgaaatcaggcagcatctttgacaattttc
ttcttacaaatgatgaagagtttgctgaagaggttggaaataagacctggggactaagaa
aagatgtagagaggcagtggagagaactgttcgaggaaatggaaaaaagaaaacaggaag
aagaagccgaggagagaaggggaaaggaggaggaaagggaaggtgacatctggggaattg
gagaagagggaagtgaagaggattttgctgaggaaccgggaaatgacaggcagatggagg
acgctgatgccgaaagagcatttctggataaaaataaagaagtccgtgttgaccagacgg
acgaactgtaa

KEGG   Miniopterus natalensis: 107541519
Entry
107541519         CDS       T05883                                 

Gene name
CALR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04145  Phagosome
mna04612  Antigen processing and presentation
mna05142  Chagas disease
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541519 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107541519 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107541519 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541519 (CALR)
   05170 Human immunodeficiency virus 1 infection
    107541519 (CALR)
   05168 Herpes simplex virus 1 infection
    107541519 (CALR)
   05163 Human cytomegalovirus infection
    107541519 (CALR)
   05169 Epstein-Barr virus infection
    107541519 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107541519 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107541519 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107541519 (CALR)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   107541519 (CALR)
Lectins [BR:mna04091]
 Calnexin / calreticulin
  107541519 (CALR)
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 107541519
NCBI-ProteinID: XP_016074093
LinkDB
Position
Unknown
AA seq 416 aa
MLLPVPLLLGLLGLAAAEPVVYFKEQFLDGDGWTDRWMESTHKSDFGKFVLSAGKFYGDL
DKDKGLQTSQDARFYALSARFEPFSNKDQTLVVQFTVKHEQNIDCGGGYVKLFPDSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEADKDDEEDKDDDEDDEDDKDEEEEEDGAAGQAKDEL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctgctacctgtgccgctgctgctcggccttctcggcctggctgctgctgaacccgtc
gtctacttcaaggagcagtttctggacggagatgggtggactgaccgctggatggaatcc
acacacaagtcggattttggcaaattcgtcctcagtgccggcaagttctatggtgacctg
gacaaagataaagggctgcagacgagccaggatgcccgcttttacgccctgtctgccaga
tttgagcctttcagcaacaaggaccagacattggtggtgcagtttactgtgaaacacgag
cagaacatcgactgtgggggcggctatgtgaagctatttccagatagtttggatcagact
gacatgcatggagactctgaatacaacatcatgtttggtcctgacatctgtggccccggc
accaagaaggttcatgtcattttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgaattcacacacctgtacacactaattgtgcggcctgataac
acctatgaggtaaaaattgacaacagccaggtggagtcagggtctctggaggatgattgg
gacttcctgccacccaagaagataaaggatcctgatgcttcaaagcctgaagactgggac
gaacgggccaagattgatgaccccacagactccaaacctgaggactgggacaagcccgag
cacatccctgaccccgatgctaagaaacctgaggactgggatgaagagatggatggagag
tgggaaccaccggtgattcagaacccagaatacaagggcgagtggaagccccggcagatt
gacaacccggattataagggcacttggatccacccagagattgacaacccggagtactct
cctgatagcaatatctatgcctatgaaaacttcgccgttctgggcctagacctctggcag
gtcaagtctggtaccatctttgacaacttcctcatcaccaatgatgaagcatatgctgaa
gagttcggcaatgagacgtggggcgtcacaaaggcagcagaaaagcaaatgaaggataag
caggatgaagagcagagactgaaggaggaggaggaggacaagaagcgcaaggaggaggaa
gcagacaaggacgacgaggaggacaaagacgatgatgaggatgacgaggacgataaggac
gaggaggaggaggaagatggtgccgctggccaggccaaggatgagctgtag

DBGET integrated database retrieval system