KEGG   Miniopterus natalensis: 107538045
Entry
107538045         CDS       T05883                                 

Gene name
GNRH1
Definition
(RefSeq) progonadoliberin-1
  KO
K05252  gonadotropin-releasing hormone
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
mna04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107538045 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107538045 (GNRH1)
   04912 GnRH signaling pathway
    107538045 (GNRH1)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 107538045
NCBI-ProteinID: XP_016069671
LinkDB
Position
Unknown
AA seq 103 aa
MFLRMEPIPKLLAGLILLTWCVVGCSGQHWSYGLRPGGKRNAENLIDSFQEVTKVVDQLA
EPQRFKCILHKPRSALGELEGALESLIEEETGQKNFNPLVQKE
NT seq 312 nt   +upstreamnt  +downstreamnt
atgttccttagaatggagcccattccaaaacttcttgctggacttattctgttgacttgg
tgtgtggtgggctgctccggccagcactggtcctatgggttgcgccctgggggaaaaaga
aatgcagaaaatttgattgattcttttcaagaggtaaccaaagtggtggatcaactagca
gaacctcagcgcttcaaatgcatcctccacaagccacgttctgccctcggggagctggaa
ggagcgctggagagtctgattgaagaggaaactgggcagaagaatttcaatccactggtc
cagaaggagtga

DBGET integrated database retrieval system