KEGG   Miniopterus natalensis: 107538122
Entry
107538122         CDS       T05883                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04217  Necroptosis
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04725  Cholinergic synapse
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05140  Leishmaniasis
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107538122 (JAK2)
   04151 PI3K-Akt signaling pathway
    107538122 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107538122 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107538122 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107538122 (JAK2)
   04659 Th17 cell differentiation
    107538122 (JAK2)
   04062 Chemokine signaling pathway
    107538122 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107538122 (JAK2)
   04917 Prolactin signaling pathway
    107538122 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    107538122 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    107538122 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538122 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107538122 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107538122 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107538122 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107538122 (JAK2)
   05164 Influenza A
    107538122 (JAK2)
   05168 Herpes simplex virus 1 infection
    107538122 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538122 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107538122 (JAK2)
   05140 Leishmaniasis
    107538122 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107538122 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107538122 (JAK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107538122 (JAK2)
Protein kinases [BR:mna01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   107538122 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 107538122
NCBI-ProteinID: XP_016069747
LinkDB
Position
Unknown
AA seq 1132 aa
MEMACLTMTEMEGTHTSPVHQNGDIPGMADSVKQIDSVLQVYLYHSLGKTEGDYLKFPTG
EYVAEEICVAASKACGITPLYHNMFALMSETERIWYPPNHVFHIDESTRHNVFYRIRFYF
PYWYCSGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLDIYSSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKECETLTEQDLQLYCDFPDIIDVSIKQANQEGSNESRIVTIHKQDGKNLEIELSSLK
EALSFVSLIDGYYRLTADAHHYLCKEVASPVVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKEFNKYFLTFAVERENVIEYKHCLITKNENGEYNLTGTKKNFSNLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNSVSDVPTSPTLQRHNNVNQMVFHKI
RNEDLVFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKNLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISVTVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESRFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRHLALRVDQIRDNMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggaaatggcttgccttacaatgacagaaatggaaggaacacacacatctcctgtacat
cagaatggtgatatccctggaatggctgattctgtgaaacaaatagattcagtcctacag
gtgtatctttatcattcccttgggaaaactgagggagattacctgaagtttccaactggg
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcctgtggaatcacacctttg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccgcccaaccac
gtcttccacatagatgaatcaaccaggcacaatgtattctacagaataaggttttacttt
ccttactggtattgcagcggcagcaacagaacgtatcggcatggaatatctcgaggtgct
gaagctccccttcttgacgactttgtcatgtcttacctttttgctcagtggcgtcatgat
tttttgcatggatggataaaagtacctgtgacccatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaatgaccaaaccccactcgacatc
tatagctctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaagaaagcgaataaggtacagatttcgcagatttattgagcagttc
agccattgcaaagccactgccagaaatttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaatgtgagacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaagcaggcaaatcaagaaggctcaaatgaaagcaga
attgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaaag
gaagctttgtcttttgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcatctccagtggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgccataagtaaactgaagaaagcaggtaatcagact
ggactatatgtacttcgatgcagtcctaaggagtttaataaatattttttgacttttgct
gttgagcgagaaaatgtcattgaatataagcactgtttgattacaaaaaatgagaatgga
gaatacaacctcactgggactaagaagaacttcagtaatcttaaagatcttttgaattgc
taccagatggaaactgttcgctcagacaatataattttccagtttacaaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatagtgtttctgatgta
ccaacctcaccaacactacagaggcataataatgtgaaccaaatggtgtttcacaaaatc
agaaatgaagatttggtatttaatgaaagccttggccaaggcacttttacaaaaattttc
aaaggtataagaagagaagtaggagactatggtcaactacatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaagcacctggttttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggagtttgtgaaatttggatcactagatacatatttgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacaattggcatgggcc
atgcattttctagaagaaaaaaaccttattcatgggaatgtatgtgccaaaaatattcta
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtgttacagttttgccaaaggacattcttcaggagagaataccatgggtaccg
cctgaatgcattgaaaatcctaaaaatttaaacttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagcggaggagataagcctctgagtgctttggattctcaa
agaaagctacagttttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gccaatcttattaataattgtatggattatgagccagattttagaccttctttcagagcc
atcatacgagatcttaatagtttgtttactccagattatgaactattaacagagaatgac
atgttaccaaatatgaggataggtgccctagggttttctggggcttttgaagaccgagac
cctactcagtttgaagagagacacttgaaatttctgcagcaacttggcaagggtaatttt
gggagtgtcgagatgtgccggtatgatcctctacaagacaacactggggaggtggtggct
gtgaaaaaactccagcacagtactgaagagcacctcagagactttgaaagggaaatcgaa
atccttaaatccctgcagcatgacaacattgtaaagtacaagggagtgtgctatagtgct
ggccggcgtaatctaagattaattatggaatatttaccatatggaagtttacgagactat
ctccaaaagcataaagaacgaatagatcataaaaaacttctgcagtatacatctcaaata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggacctggcaacaagg
aatatattggtggagaatgaaaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactacaaagtgaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaggttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacctatattgagaagagtaaaagtccaccagcggaa
ttcatgcgtatgattggcaacgacaaacaagggcagatgattgtgttccacttgatagag
ctcctgaagaacaacgggcggctacccagaccagatggctgcccggacgagatttatgtg
atcatgacagaatgttggaataataatgtaaatcagcgcccctctttcagacacctagct
cttcgagttgatcaaataagggacaacatggctggatga

DBGET integrated database retrieval system