KEGG   Miniopterus natalensis: 107538152
Entry
107538152         CDS       T05883                                 

Gene name
SLC5A7
Definition
(RefSeq) high affinity choline transporter 1
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107538152 (SLC5A7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107538152 (SLC5A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107538152 (SLC5A7)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   107538152 (SLC5A7)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 107538152
NCBI-ProteinID: XP_016069798
LinkDB
Position
Unknown
AA seq 580 aa
MAFHVEGLIAIILFYLLILLVGIWAAWRTKDSGSAGERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPDYGLAWAQAPIGYSLSLVLGGLFFAKPMRSRGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVHASVIVSAFIAILYTLVGG
LYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTSIGFTSTHTKYQAPWLGTIESFEVYTW
LDSFLLLILGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAVLIGAIGASTDW
NQTAYGVPDPKSKEEADMILPIVLQHLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDREIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYTILFPQ
LLCVLFVKGTNTYGAAAGYASGLFLRITGGEPYLYLQPLFFYPGYYSDKNGIYNQRFPFK
TLAMASSFLTNIGVSYLAKYLFESGTLPPKLDVLDAVVARHSEENMDKTMLVRNENIKLD
ELAPVKPRQSLRRSSTFTHAEAFLHVDSSPEGSGPEDNLQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggctttccacgtggaaggactgatagcaatcatcctgttctaccttctaatattgctg
gttggaatatgggccgcctggaggaccaaggacagtgggagcgcgggcgagcggagcgag
gccatcatcgtgggcggcagggacatcggcctgctggtgggcggcttcaccatgacagcc
acctgggtcggaggaggttacatcaacgggacggcggaagcagtgtacgtaccagattac
gggctagcgtgggcgcaagcaccaattggatattctcttagcctggttttaggtggtctg
ttttttgcaaaacctatgcgttcccggggctacgtgaccatgttagacccatttcagcag
atctatggaaaacgcatgggcggcctcctctttattccagcactgatgggggagatgttc
tgggcggcagctatcttctcggccctaggcgccaccatcagcgtgatcattgacgtggac
gtgcatgcctctgtcatcgtctccgcgttcatcgccattctctacacgctggtgggcggc
ctctactccgtggcctacacggacgtcgtgcagctcttctgtattttcataggactgtgg
atcagcgtccccttcgcattgtcacatcccgccgtcaccagcattgggttcacctctaca
cataccaagtaccaggctccttggctggggaccatcgaatcgtttgaagtctacacttgg
cttgatagctttctgttgttgattctgggtggaatcccgtggcaggcctacttccagagg
gtcctctcttcctcctcagccacctacgcgcaggtgctgtccttcctggcggccttcggg
tgcctggtgatggccatcccagcggtgctcatcggggccattggcgcgtcgacagactgg
aaccagactgcgtacggggttccggaccccaagagcaaggaggaagccgacatgatcttg
ccgatcgtcctgcagcacctctgccccgtgtacatctccttcttcgggctgggcgcggtg
tcggccgccgtgatgtcctcggcggattcctccatcctgtcggccagctccatgtttgct
cgcaacatctaccagctctccttcaggcagaacgcctcggaccgggagatcgtgtgggtc
atgcgcatcaccgtgttcgtgttcggcgcgtcggccaccgccatggccctgctcaccaag
acggtgtacgggctctggtacctgagctccgacctggtctacaccatcctgttcccgcag
ctgctgtgcgtgctgttcgtcaagggcaccaacacgtacggcgcggcggccggctacgcc
tcggggctcttcctgcgcatcacgggcggggagccctacctctacctgcagcccctgttc
ttctaccccggctactactccgacaagaacggcatctacaaccagcggttccccttcaaa
accctggccatggccagctcctttctcaccaacatcggcgtctcctacctggccaagtac
ctgttcgagagcgggaccctgccccccaagctggacgtcctggacgccgtggtcgccagg
cacagcgaggagaacatggacaagaccatgctggtccgaaacgagaacatcaagctggac
gagctggcgcccgtgaagccgcggcagagcctgcggcgcagctccaccttcacgcacgcc
gaggcctttctgcacgtggactccagccccgagggctcggggcccgaggacaacctgcag
tga

DBGET integrated database retrieval system