KEGG   Miniopterus natalensis: 107538300
Entry
107538300         CDS       T05883                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538300 (PRKCA)
   04012 ErbB signaling pathway
    107538300 (PRKCA)
   04014 Ras signaling pathway
    107538300 (PRKCA)
   04015 Rap1 signaling pathway
    107538300 (PRKCA)
   04310 Wnt signaling pathway
    107538300 (PRKCA)
   04370 VEGF signaling pathway
    107538300 (PRKCA)
   04066 HIF-1 signaling pathway
    107538300 (PRKCA)
   04020 Calcium signaling pathway
    107538300 (PRKCA)
   04070 Phosphatidylinositol signaling system
    107538300 (PRKCA)
   04072 Phospholipase D signaling pathway
    107538300 (PRKCA)
   04071 Sphingolipid signaling pathway
    107538300 (PRKCA)
   04151 PI3K-Akt signaling pathway
    107538300 (PRKCA)
   04150 mTOR signaling pathway
    107538300 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107538300 (PRKCA)
   04540 Gap junction
    107538300 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107538300 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    107538300 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    107538300 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    107538300 (PRKCA)
   04670 Leukocyte transendothelial migration
    107538300 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    107538300 (PRKCA)
   04929 GnRH secretion
    107538300 (PRKCA)
   04912 GnRH signaling pathway
    107538300 (PRKCA)
   04921 Oxytocin signaling pathway
    107538300 (PRKCA)
   04926 Relaxin signaling pathway
    107538300 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    107538300 (PRKCA)
   04918 Thyroid hormone synthesis
    107538300 (PRKCA)
   04919 Thyroid hormone signaling pathway
    107538300 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    107538300 (PRKCA)
   04916 Melanogenesis
    107538300 (PRKCA)
   04925 Aldosterone synthesis and secretion
    107538300 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107538300 (PRKCA)
   04270 Vascular smooth muscle contraction
    107538300 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    107538300 (PRKCA)
   04971 Gastric acid secretion
    107538300 (PRKCA)
   04972 Pancreatic secretion
    107538300 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107538300 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107538300 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107538300 (PRKCA)
   04727 GABAergic synapse
    107538300 (PRKCA)
   04725 Cholinergic synapse
    107538300 (PRKCA)
   04728 Dopaminergic synapse
    107538300 (PRKCA)
   04726 Serotonergic synapse
    107538300 (PRKCA)
   04720 Long-term potentiation
    107538300 (PRKCA)
   04730 Long-term depression
    107538300 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    107538300 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107538300 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    107538300 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107538300 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538300 (PRKCA)
   05206 MicroRNAs in cancer
    107538300 (PRKCA)
   05205 Proteoglycans in cancer
    107538300 (PRKCA)
   05231 Choline metabolism in cancer
    107538300 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107538300 (PRKCA)
   05214 Glioma
    107538300 (PRKCA)
   05223 Non-small cell lung cancer
    107538300 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107538300 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    107538300 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107538300 (PRKCA)
   05032 Morphine addiction
    107538300 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107538300 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107538300 (PRKCA)
   05161 Hepatitis B
    107538300 (PRKCA)
   05171 Coronavirus disease - COVID-19
    107538300 (PRKCA)
   05164 Influenza A
    107538300 (PRKCA)
   05163 Human cytomegalovirus infection
    107538300 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107538300 (PRKCA)
   05143 African trypanosomiasis
    107538300 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107538300 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107538300 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107538300 (PRKCA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107538300 (PRKCA)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107538300 (PRKCA)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107538300 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C APH C1_2
Other DBs
NCBI-GeneID: 107538300
NCBI-ProteinID: XP_016069997
LinkDB
Position
Unknown
AA seq 636 aa
MTCVCTSCGRVPAASVLPSSWPRSGQVFFSLPPVCCFVVHKRCHEFVTFSCPGADKGPDT
DDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDH
TEKRGRIYLKAEVTDEKLHVTVQDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTI
RSTLNPQWNESFTFKLKPSDKDRRLSIEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWY
KLLNQEEGEYYNVPIPEGDEEGNAELRQKFEKAKLGPAGHRGYGPSEDRRLSNNLDRVKL
TDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDK
PPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHK
RGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYG
KSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKH
PGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPV
LTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgacgtgcgtctgcacgtcttgcggcagagtgcctgctgcctcggtgctgccctcctcc
tggccaaggtcaggccaagttttcttttctcttcccccagtttgctgttttgtggttcac
aagaggtgccatgaatttgttactttctcgtgtccgggtgcggataagggacccgacacc
gatgacccccggagcaagcacaagttcaaaatccacacctatggaagccccaccttctgt
gaccactgcgggtcgctgctgtatggactcatccaccagggcatgaaatgcgacacctgc
gacatgaacgtgcacaagcagtgtgtgatcaacgtccccagcctctgcgggatggaccac
acggagaagcggggccggatctacctgaaggccgaggtcaccgatgaaaagctccacgtc
acagtccaagatgcgaaaaatctaatccccatggatccgaatggactttcagacccctat
gtgaagctgaaactcattcccgatcccaagaacgaaagtaaacagaaaaccaaaaccatc
cgctctactctcaacccccagtggaacgagtccttcacgttcaaattaaaaccttcagat
aaagaccgacgactgtccatagaaatctgggactgggatcggacaacacggaatgacttc
atggggtcgctttcctttggcgtttcggagctgatgaagatgccggccagcggatggtac
aagttgcttaaccaggaggaaggtgagtactacaacgtgcccattccagaaggagatgaa
gaagggaacgcggaactcaggcagaagttcgagaaagccaagctcggccccgccggtcac
agaggctacggcccttcggaagacaggagactttccaacaacctggaccgggtgaagctt
accgacttcaacttcctcatggtgctggggaagggcagcttcgggaaggtgatgctggct
gacaggaaggggacagaagaactctatgccatcaaaatcctgaaaaaagacgtagtgatt
caagatgacgacgtggagtgcaccatggtggagaagcgggtcctggccctgctcgacaag
cccccgttcctgacgcagctgcactcctgcttccagacagtggaccggctgtacttcgtc
atggaatacgtcaacggcggggacctcatgtaccacattcagcaagtaggaaagtttaag
gagccacaagcagtattctatgcagcggagatttccattgggctgttctttcttcataaa
agaggaatcatttacagggacctgaagctggataatgtcatgctggactccgaggggcac
atcaagattgctgacttcgggatgtgcaaggaacacatgatggacggcgtcacgaccagg
accttctgcgggaccccagattacatcgccccggagataatcgcttaccagccgtatggg
aaatccgtggactggtgggcctacggcgtcctgctgtacgaaatgctggctgggcagcct
ccgtttgatggcgaagacgaagacgagctgtttcagtctataatggagcacaacgtttcc
tacccgaaatccttgtccaaggaggccgtttccatctgcaaggggctgatgaccaaacac
ccaggcaagcggctgggctgcgggcccgagggagagcgggacgtgcgagaacacgccttc
ttccggagaatcgactgggagaaactggagaacagggagatccagccgcccttcaagccc
aaagtgtgtggcaaaggagcggaaaacttcgacaagttcttcacgcgagggcagcccgtc
ttaacacctcccgatcagctggtcatcgctaacatagaccagtctgatttcgaagggttc
tcgtatgtcaacccccagtttgtgcaccccatcttacagagcgcagtatga

KEGG   Miniopterus natalensis: 107540426
Entry
107540426         CDS       T05883                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04150  mTOR signaling pathway
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540426 (PRKCG)
   04012 ErbB signaling pathway
    107540426 (PRKCG)
   04014 Ras signaling pathway
    107540426 (PRKCG)
   04015 Rap1 signaling pathway
    107540426 (PRKCG)
   04310 Wnt signaling pathway
    107540426 (PRKCG)
   04370 VEGF signaling pathway
    107540426 (PRKCG)
   04066 HIF-1 signaling pathway
    107540426 (PRKCG)
   04020 Calcium signaling pathway
    107540426 (PRKCG)
   04070 Phosphatidylinositol signaling system
    107540426 (PRKCG)
   04071 Sphingolipid signaling pathway
    107540426 (PRKCG)
   04150 mTOR signaling pathway
    107540426 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107540426 (PRKCG)
   04540 Gap junction
    107540426 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107540426 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    107540426 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    107540426 (PRKCG)
   04670 Leukocyte transendothelial migration
    107540426 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    107540426 (PRKCG)
   04929 GnRH secretion
    107540426 (PRKCG)
   04921 Oxytocin signaling pathway
    107540426 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    107540426 (PRKCG)
   04918 Thyroid hormone synthesis
    107540426 (PRKCG)
   04919 Thyroid hormone signaling pathway
    107540426 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    107540426 (PRKCG)
   04916 Melanogenesis
    107540426 (PRKCG)
   04925 Aldosterone synthesis and secretion
    107540426 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107540426 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    107540426 (PRKCG)
   04971 Gastric acid secretion
    107540426 (PRKCG)
   04972 Pancreatic secretion
    107540426 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107540426 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107540426 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540426 (PRKCG)
   04727 GABAergic synapse
    107540426 (PRKCG)
   04725 Cholinergic synapse
    107540426 (PRKCG)
   04728 Dopaminergic synapse
    107540426 (PRKCG)
   04726 Serotonergic synapse
    107540426 (PRKCG)
   04720 Long-term potentiation
    107540426 (PRKCG)
   04730 Long-term depression
    107540426 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    107540426 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107540426 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540426 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540426 (PRKCG)
   05206 MicroRNAs in cancer
    107540426 (PRKCG)
   05205 Proteoglycans in cancer
    107540426 (PRKCG)
   05231 Choline metabolism in cancer
    107540426 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107540426 (PRKCG)
   05214 Glioma
    107540426 (PRKCG)
   05223 Non-small cell lung cancer
    107540426 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107540426 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    107540426 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    107540426 (PRKCG)
   05032 Morphine addiction
    107540426 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540426 (PRKCG)
   05161 Hepatitis B
    107540426 (PRKCG)
   05171 Coronavirus disease - COVID-19
    107540426 (PRKCG)
   05163 Human cytomegalovirus infection
    107540426 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107540426 (PRKCG)
   05143 African trypanosomiasis
    107540426 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107540426 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107540426 (PRKCG)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107540426 (PRKCG)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107540426 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 107540426
NCBI-ProteinID: XP_016072669
LinkDB
Position
Unknown
AA seq 652 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVLYKLLNQEEGEY
YNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGR
LHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLAL
GGRGPGGRPHFLTQLHSTFQTPVRXXXVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIA
IGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGNTTRTFCGTPDYIAPE
IIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAI
CKGFLTKHPAKRLGSGPDGEPTIRTHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDK
FFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPAPVPVM
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggcccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctgggggattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcaccgccgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccggaacaag
cacaagttccgcctgcacagctacagcagcccgaccttctgcgaccactgcggctcgctc
ctgtacgggctggtgcaccagggcatgaagtgctcctgttgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggcgtggaccacacggagcgccgcgggcgc
ctgcagctggaaatccgggctcccactgcggatgagatccacatcacggtcggcgaggcc
cggaacctcatcccgatggaccccaacggcctgtccgacccctacgtgaaactgaagctc
atccctgaccctcggaacctgacaaaacagaagacccggacagtgaaagccacgctgaac
cctgtgtggaacgagacctttgtgttgtacaagctactgaaccaggaggagggcgagtat
tacaatgtccccgtggctgatgctgacaactgcagcctcctccagaagtttgaggcctgt
aactaccccctggaactgtatgagcgggtgcggatgggtccttcttcctctcccatcccc
tccccatcccctagtcccacggactccaagcgctgtttcttcggggcgagccctggacgg
ctgcatatctccgacttcagcttcctcatggttcttggaaaaggcagctttgggaaggtg
atgctggctgagcgcaggggctccgatgagctctacgccatcaagatcctgaagaaagac
gtgatcgtccaggacgacgacgtggactgcaccctggtggagaagcgcgtgctggctctg
gggggccgaggcccggggggccggccccacttcctcacccagctccactccaccttccag
accccggtaaggnnnnnnnncgtgatggagtacgtcaccgggggcgacctgatgtaccac
atccagcagctgggcaagttcaaggagccccatgccgcgttctacgccgcggaaatcgcc
atcggcctcttcttcctgcacaatcaaggcatcatctaccgggacctgaagctggacaac
gtgatgctggatgcggaggggcacatcaaaatcaccgacttcggcatgtgcaaggagaac
gtcttccctgggaacacgactcgcaccttctgcgggaccccggactacatagcccccgag
atcattgcttaccagccctacgggaaatctgtcgactggtggtcctttggggttctactg
tacgagatgttggcgggacagcccccctttgatggggaagatgaggaggagctctttcag
gccatcatggaacaaactgtcacctaccccaagtcgctctcccgggaggccgtggccatc
tgcaaggggttcctaaccaaacacccagcgaagcgcctgggctcagggcctgacggggag
cccaccatccgtactcatggctttttccgctggatcgactgggaacggctggagcggctg
gagatcccacctccgttcagaccccgcccatgtggccgcagcggcgagaacttcgacaag
ttcttcacgcgggcggcgccagcgctgacccccccagaccgcctcgtcctggccagcatc
gaccaggccgacttccagggcttcacctacgtgaacccggatttcgtgcaccccgacgcc
cgcagccccaccagccccgcgcctgtgccggtcatgtaa

KEGG   Miniopterus natalensis: 107544745
Entry
107544745         CDS       T05883                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04150  mTOR signaling pathway
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04662  B cell receptor signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05140  Leishmaniasis
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544745 (PRKCB)
   04012 ErbB signaling pathway
    107544745 (PRKCB)
   04014 Ras signaling pathway
    107544745 (PRKCB)
   04015 Rap1 signaling pathway
    107544745 (PRKCB)
   04310 Wnt signaling pathway
    107544745 (PRKCB)
   04370 VEGF signaling pathway
    107544745 (PRKCB)
   04064 NF-kappa B signaling pathway
    107544745 (PRKCB)
   04066 HIF-1 signaling pathway
    107544745 (PRKCB)
   04020 Calcium signaling pathway
    107544745 (PRKCB)
   04070 Phosphatidylinositol signaling system
    107544745 (PRKCB)
   04071 Sphingolipid signaling pathway
    107544745 (PRKCB)
   04150 mTOR signaling pathway
    107544745 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107544745 (PRKCB)
   04540 Gap junction
    107544745 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107544745 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    107544745 (PRKCB)
   04662 B cell receptor signaling pathway
    107544745 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    107544745 (PRKCB)
   04670 Leukocyte transendothelial migration
    107544745 (PRKCB)
   04062 Chemokine signaling pathway
    107544745 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    107544745 (PRKCB)
   04929 GnRH secretion
    107544745 (PRKCB)
   04912 GnRH signaling pathway
    107544745 (PRKCB)
   04921 Oxytocin signaling pathway
    107544745 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    107544745 (PRKCB)
   04918 Thyroid hormone synthesis
    107544745 (PRKCB)
   04919 Thyroid hormone signaling pathway
    107544745 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    107544745 (PRKCB)
   04916 Melanogenesis
    107544745 (PRKCB)
   04925 Aldosterone synthesis and secretion
    107544745 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544745 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    107544745 (PRKCB)
   04971 Gastric acid secretion
    107544745 (PRKCB)
   04972 Pancreatic secretion
    107544745 (PRKCB)
   04973 Carbohydrate digestion and absorption
    107544745 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107544745 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107544745 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107544745 (PRKCB)
   04727 GABAergic synapse
    107544745 (PRKCB)
   04725 Cholinergic synapse
    107544745 (PRKCB)
   04728 Dopaminergic synapse
    107544745 (PRKCB)
   04726 Serotonergic synapse
    107544745 (PRKCB)
   04720 Long-term potentiation
    107544745 (PRKCB)
   04730 Long-term depression
    107544745 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    107544745 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107544745 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107544745 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544745 (PRKCB)
   05206 MicroRNAs in cancer
    107544745 (PRKCB)
   05205 Proteoglycans in cancer
    107544745 (PRKCB)
   05231 Choline metabolism in cancer
    107544745 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107544745 (PRKCB)
   05214 Glioma
    107544745 (PRKCB)
   05223 Non-small cell lung cancer
    107544745 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107544745 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    107544745 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107544745 (PRKCB)
   05032 Morphine addiction
    107544745 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107544745 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107544745 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107544745 (PRKCB)
   05161 Hepatitis B
    107544745 (PRKCB)
   05171 Coronavirus disease - COVID-19
    107544745 (PRKCB)
   05164 Influenza A
    107544745 (PRKCB)
   05163 Human cytomegalovirus infection
    107544745 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107544745 (PRKCB)
   05140 Leishmaniasis
    107544745 (PRKCB)
   05143 African trypanosomiasis
    107544745 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107544745 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544745 (PRKCB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107544745 (PRKCB)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107544745 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 107544745
NCBI-ProteinID: XP_016078145
LinkDB
Position
Unknown
AA seq 625 aa
MRRCEHRGFFLPACTPGLARVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHT
YSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHI
EREVLTVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFR
FQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNV
PVPPEGGEGNEELRQKFERAKIGQAPKTPEEKTTNTIAKFDNNGNRDRMKLSDFNFLMVL
GKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHS
CFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLK
LDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFG
VLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGP
EGERDIREHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVI
RNIDQSEFEGFSFVNSEFLKPEVKS
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgcgacggtgcgaacaccgcggcttctttctccccgcctgcacccctgggcttgcgcgg
gtctgctgttttgtcgtccacaagcggtgccatgaatttgtcactttctcctgcccaggc
gctgacaagggtcccgcctctgatgacccccggagcaaacacaagtttaagatccacaca
tactccagccccacgttttgtgaccactgtgggtcgctgctgtatggactcatccaccag
gggatgaagtgtgacacctgcatgatgaacgtccacaagcgctgcgtgatgaatgtcccc
agcctctgcggcaccgaccacacagagcgccgtggccgcatctacatccaggcgcacatc
gagagggaggtcctcaccgtcctggtaagagatgctaaaaacctggtacccatggacccc
aatggcctgtcagatccctatgtgaaactgaaactcattcctgaccccaaaagtgagagc
aaacagaagaccaaaactatcaagtgctccctcaaccccgagtggaacgagacattcaga
ttccagctgaaggaatcggacaaagacaggagactgtccgtggagatctgggattgggac
ctgaccagccggaatgacttcatgggatctctgtcgtttgggatttctgagctgcagaaa
gctggtgtcgatggctggtttaagctgctgagccaggaggagggcgagtactttaacgtg
cccgtgccgccagagggaggcgagggcaatgaggagctgcggcagaaatttgagagggcc
aagatcggccaggcacccaagactccggaagaaaagacgaccaacaccatagccaaattt
gacaacaatgggaacagggaccgcatgaagctgagtgattttaacttcctgatggtgctt
gggaaaggcagctttggcaaggtcatgctctcggagcgaaaaggcacggatgagctctac
gccgtgaagatcctgaagaaggatgttgtgatccaggacgatgacgttgagtgcaccatg
gtggagaagcgggtgctggccctgcccgggaagccgcccttcctgacccagctgcactcc
tgcttccagaccatggaccgcctgtacttcgtgatggagtacgtgaacggcggggacctc
atgtaccacatccagcaggtcggccgctttaaggagcctcacgccgtgttttacgctgca
gaaatcgccatcggcctgttctttctgcagagcaagggcatcatttaccgtgacctaaaa
cttgacaacgtgatgctggattccgagggccacatcaagatcgctgactttggcatgtgc
aaggagaacatctgggatggggtgacgaccaaaacattctgcgggactccagactacatc
gcccccgagatcattgcgtatcagccctacgggaagtcggtggactggtgggcattcgga
gtcctgctgtatgagatgctggccgggcaggcgcccttcgaaggggaagatgaagacgag
ctcttccagtccatcatggagcacaacgtggcgtatccgaagtccatgtccaaggaggcc
gtggccatctgcaaagggctgatgaccaaacacccgggcaagcgtctgggctgcgggccc
gaaggcgagcgcgacatcagggagcacgcgttcttccgctacatcgactgggagaagctg
gagcgcaaagagattcagcccccgtacaagcccaaagcctgtgggcgaaatgctgaaaac
ttcgaccggtttttcacccgccatccaccagtcctaacacctcccgaccaggaagtcatc
aggaatattgaccagtcagaattcgaaggattttcctttgttaactctgaatttttaaaa
cctgaagtcaagagctaa

DBGET integrated database retrieval system