KEGG   Miniopterus natalensis: 107538414
Entry
107538414         CDS       T05883                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04660  T cell receptor signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04912  GnRH signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538414 (CDC42)
   04014 Ras signaling pathway
    107538414 (CDC42)
   04015 Rap1 signaling pathway
    107538414 (CDC42)
   04370 VEGF signaling pathway
    107538414 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538414 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107538414 (CDC42)
   04520 Adherens junction
    107538414 (CDC42)
   04530 Tight junction
    107538414 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107538414 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107538414 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    107538414 (CDC42)
   04670 Leukocyte transendothelial migration
    107538414 (CDC42)
   04062 Chemokine signaling pathway
    107538414 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107538414 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107538414 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    107538414 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538414 (CDC42)
   05205 Proteoglycans in cancer
    107538414 (CDC42)
   05203 Viral carcinogenesis
    107538414 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107538414 (CDC42)
   05211 Renal cell carcinoma
    107538414 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107538414 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107538414 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107538414 (CDC42)
   05135 Yersinia infection
    107538414 (CDC42)
   05100 Bacterial invasion of epithelial cells
    107538414 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107538414 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107538414 (CDC42)
   03036 Chromosome and associated proteins [BR:mna03036]
    107538414 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538414 (CDC42)
   04031 GTP-binding proteins [BR:mna04031]
    107538414 (CDC42)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107538414 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107538414 (CDC42)
  Macropinocytosis
   Ras GTPases
    107538414 (CDC42)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107538414 (CDC42)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107538414 (CDC42)
  Exosomal proteins of breast milk
   107538414 (CDC42)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107538414 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 107538414
NCBI-ProteinID: XP_016070136
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaaatgcgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatctgaatatgtacctactgtttttgacaactat
gcagtgacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttctgtggtttctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcatcattgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaaacctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

KEGG   Miniopterus natalensis: 107540891
Entry
107540891         CDS       T05883                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04660  T cell receptor signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04912  GnRH signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540891
   04014 Ras signaling pathway
    107540891
   04015 Rap1 signaling pathway
    107540891
   04370 VEGF signaling pathway
    107540891
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107540891
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107540891
   04520 Adherens junction
    107540891
   04530 Tight junction
    107540891
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107540891
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107540891
   04666 Fc gamma R-mediated phagocytosis
    107540891
   04670 Leukocyte transendothelial migration
    107540891
   04062 Chemokine signaling pathway
    107540891
  09152 Endocrine system
   04912 GnRH signaling pathway
    107540891
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107540891
  09158 Development and regeneration
   04360 Axon guidance
    107540891
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540891
   05205 Proteoglycans in cancer
    107540891
   05203 Viral carcinogenesis
    107540891
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107540891
   05211 Renal cell carcinoma
    107540891
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107540891
   04933 AGE-RAGE signaling pathway in diabetic complications
    107540891
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107540891
   05135 Yersinia infection
    107540891
   05100 Bacterial invasion of epithelial cells
    107540891
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107540891
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107540891
   03036 Chromosome and associated proteins [BR:mna03036]
    107540891
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540891
   04031 GTP-binding proteins [BR:mna04031]
    107540891
Membrane trafficking [BR:mna04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107540891
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107540891
  Macropinocytosis
   Ras GTPases
    107540891
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107540891
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107540891
  Exosomal proteins of breast milk
   107540891
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107540891
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107540891
NCBI-ProteinID: XP_016073238
LinkDB
Position
Unknown
AA seq 172 aa
MQTIKCIVVGDGAVGKTCLLTSYTTNKFPSEYVRTVFLFCPTVFDNYAVTVMIGGEPYTL
GLFDTAGQEDYDRLRLLSYLQTDAFLVCFSVVSPSSFENVKEKRGPEIIHHCPKTSFLLV
GTQIDLRDDPSIEKLAKNKQKSIIPETAEKLACDLKAVKYVDTHTERPKECI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcattgttgtgggtgatggtgctgttggaaaaacatgtctcctg
acatcctacacaacaaacaaatttccatctgaatatgtacggactgtttttttgttttgc
ccgactgtttttgacaactatgcagtgacagttatgattggtggagagccatatactctt
ggactttttgatactgcagggcaagaggattatgacagactacgactgctgagttatcta
caaacagatgcatttctagtctgtttttctgtggtttctccatcctcatttgaaaatgtg
aaagaaaagagggggcctgagataattcaccattgtccaaagacttctttcttgcttgtt
ggaacccaaattgatctcagagatgacccctctattgagaaacttgccaagaacaaacag
aaatctatcattccagagactgctgaaaagctggcctgtgacctgaaggctgtcaagtat
gtggacacacacacagaaaggcctaaagaatgtatttga

DBGET integrated database retrieval system