KEGG   Miniopterus natalensis: 107538557
Entry
107538557         CDS       T05883                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04670  Leukocyte transendothelial migration
mna04912  GnRH signaling pathway
mna05135  Yersinia infection
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107538557 (PTK2B)
   04072 Phospholipase D signaling pathway
    107538557 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107538557 (PTK2B)
   04670 Leukocyte transendothelial migration
    107538557 (PTK2B)
   04062 Chemokine signaling pathway
    107538557 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107538557 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107538557 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107538557 (PTK2B)
   05161 Hepatitis B
    107538557 (PTK2B)
   05163 Human cytomegalovirus infection
    107538557 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107538557 (PTK2B)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107538557 (PTK2B)
Protein kinases [BR:mna01001]
 Non-receptor tyrosine kinases
  FAK family
   107538557 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 107538557
NCBI-ProteinID: XP_016070328
LinkDB
Position
Unknown
AA seq 1009 aa
MSGVSEPLGRVKVGTLCRPEGPPEPMVVAPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREVIASILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKKDRTTLLYFYQQLRSDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCVLLEEGQAVLQLDIEGAPQSLSIKTSSLAEAENMADLIDGYSRLQVENRA
SLIIHPKKDGEKRNSLPQIPVLSLEARRSQLSESCSIESDIYAEIPDETLRRPGGSQYGI
AREDVVLNCILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTQDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYSYGELGHYLERNKNSLKVLTLVLYALQICKAMAYL
ESINCVHRDIAVRNILVASTECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSERPRFTELACSLSDIYQMEKDIAIEQERNARYRPPKILEPVAFQDPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFVQPSSREEAQQLWEAERLKMRQILDKQQRQMVEDYQWLRQEEKSLDPMVHMNDKSP
LTPEKEAGYTEFTGPPQKPPRLCAQSIQPTANLDRTDDMVYLNVMELVRAVLELKNELCQ
LPPEAYVVVVKNVGLTLRKLIGSVDNILPSLPLSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgggccgagtaaaggtgggcacattatgtcggccagaa
ggccccccagagcccatggtggtggcgccagtagatgtggaaaaagaagacgtgcggatc
ctcaaggtctgcttctacagcaacagcttcaaccctgggaagaacttcaaactggttaaa
tgcactgtgcagactgagatccgggaggtcattgcctccatcctgctgagcgggcggatc
gggcccaacatccagctggctgagtgctatgggctgaggctgaagcatatgaagtctgat
gagatccactggctgcacccacagatgactgtgggtgaggtgcaggacaaatatgaatgt
ctacacgtggaggctgagtggaggtatgaccttcaaatccgctacttgccagaggacttc
atggagagcttgaagaaggacaggaccacgctgctttatttttatcaacagctccggagc
gactacatgcaacgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggacatgccccacaacgcacttgacaaaaagtccaac
ttcgagctcctggagaaggaagtagggcttgacctgtttttcccaaagcagatgcaggag
aacttaaagcccaagcagttccggaagatgatccagcagacattccagcagtatgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactcttgccggctttgccaacatt
gaccaggagacctatcgctgtgaactcattcaaggatggaacatcactgtggacctggtc
attggccctaaaggcatccgccagctgacaagtcaagatgcaaagcccacctgcctggct
gagttcaagcagatcaagtccatcaggtgcgtcctgctggaggagggccaggcagtattg
cagttggacatcgaaggtgccccccagtccttgtccatcaaaacctcctctctggcagaa
gccgagaacatggctgacctcatagatggttacagccggctgcaggtggagaacagagcc
tctctcatcattcatcccaagaaagatggtgagaagcggaacagcctgccccagatccct
gtgctaagcctggaggctcggcggtcccagctctcagaaagctgcagcatagaatcagac
atctacgctgagattcctgacgagactctgcgaaggccaggaggctcacagtatggcatc
gcccgggaagatgtggttctgaactgtattcttggggaaggcttttttggggaggtctac
gaaggtgtctacacaaaccataaaggggagaaaatcaacgtagctgtgaagacctgcaag
aaagactgcacccaggacaacaaggagaagttcatgagtgaggcagtgatcatgaagaat
ctggaccacccgcatattgtgaagctgataggcatcatcgaagaggagcccacctggatc
ataatggaactgtattcctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcactctcgtcctgtacgcgctgcagatttgtaaggccatggcctacctg
gagagcatcaactgtgtccacagggacattgctgtccgaaacatcctggtggcctccacc
gagtgtgtgaagctgggggacttcggcctctcccgctacattgaggatgaagactactac
aaagcctctgtgactcgtctacccatcaagtggatgtcacctgagtctattaacttccgc
cgcttcaccacggccagtgacgtctggatgtttgctgtgtgcatgtgggagatcctgagc
tttggcaagcagcccttcttctggctggaaaacaaggatgtcatcggggtgctcgagaag
ggcgaccggctgcccaagcctgacctctgcccgcctgttctctacacccttatgacccga
tgctgggactatgaccccagtgagcggccccgcttcaccgagcttgcgtgcagcctcagt
gacatttatcagatggagaaggacatcgctatagagcaggagaggaatgctcgctaccga
cctcccaaaatcttggaacccgtagccttccaggatcccccacccaagcccagcagaccc
aagtacagaccccctccacaaaccaatcttctggcacccaagctgcaattccaggtccct
gagggtctgtgtgccagctcacctacgctcaccagccctatggagtatccatctcctgta
aactcgctgcacaccccacctctccaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggacttcgtccaacccagcagccgagaggaggcccagcagctatgggaggctgag
aggctcaagatgcggcagatcctggacaagcagcagaggcagatggtggaagattaccag
tggctgaggcaggaggagaaatccttggaccccatggttcatatgaatgacaagtccccg
ttgaccccagagaaggaggctggctacacggagttcacgggtcccccacagaagccaccg
cggctgtgtgcacagtctatccagcccacagccaacctggatcggaccgacgacatggtg
tacctcaatgtcatggagctggtgcgggctgtgctggaactcaagaatgagctctgtcag
ctgccccccgaggcctatgtggtggtggtgaagaacgtgggcctgaccctccggaagctc
atcgggagtgtggacaatatcctgccttccttgccattgtcttcacggacggagattgaa
gggacccagaaactgctcaacaaggacctggcagagctcatcaataagatgcgactggcc
cagcaaaatgccgtgacctccctgagcgaggagtgcaagcgacagatgctcacggcctcc
cataccctggccgtggacgccaagaacctgctcgatgccgtggaccaggccaaggttctg
gccaatctggctcacccacctgcagagtga

DBGET integrated database retrieval system