KEGG   Miniopterus natalensis: 107538830
Entry
107538830         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cellular tumor antigen p53-like
  KO
K04451  tumor protein p53
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04071  Sphingolipid signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04137  Mitophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04216  Ferroptosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04722  Neurotrophin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538830
   04310 Wnt signaling pathway
    107538830
   04071 Sphingolipid signaling pathway
    107538830
   04151 PI3K-Akt signaling pathway
    107538830
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107538830
  09143 Cell growth and death
   04110 Cell cycle
    107538830
   04210 Apoptosis
    107538830
   04216 Ferroptosis
    107538830
   04115 p53 signaling pathway
    107538830
   04218 Cellular senescence
    107538830
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107538830
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107538830
  09149 Aging
   04211 Longevity regulating pathway
    107538830
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538830
   05202 Transcriptional misregulation in cancer
    107538830
   05206 MicroRNAs in cancer
    107538830
   05205 Proteoglycans in cancer
    107538830
   05203 Viral carcinogenesis
    107538830
   05230 Central carbon metabolism in cancer
    107538830
  09162 Cancer: specific types
   05210 Colorectal cancer
    107538830
   05212 Pancreatic cancer
    107538830
   05225 Hepatocellular carcinoma
    107538830
   05226 Gastric cancer
    107538830
   05214 Glioma
    107538830
   05216 Thyroid cancer
    107538830
   05220 Chronic myeloid leukemia
    107538830
   05217 Basal cell carcinoma
    107538830
   05218 Melanoma
    107538830
   05219 Bladder cancer
    107538830
   05215 Prostate cancer
    107538830
   05213 Endometrial cancer
    107538830
   05224 Breast cancer
    107538830
   05222 Small cell lung cancer
    107538830
   05223 Non-small cell lung cancer
    107538830
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107538830
   05014 Amyotrophic lateral sclerosis
    107538830
   05016 Huntington disease
    107538830
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107538830
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538830
   05161 Hepatitis B
    107538830
   05160 Hepatitis C
    107538830
   05162 Measles
    107538830
   05168 Herpes simplex virus 1 infection
    107538830
   05163 Human cytomegalovirus infection
    107538830
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538830
   05169 Epstein-Barr virus infection
    107538830
   05165 Human papillomavirus infection
    107538830
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107538830
   01522 Endocrine resistance
    107538830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107538830
   03036 Chromosome and associated proteins [BR:mna03036]
    107538830
   03400 DNA repair and recombination proteins [BR:mna03400]
    107538830
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107538830
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107538830
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107538830
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 107538830
NCBI-ProteinID: XP_016070651
LinkDB
Position
Unknown
AA seq 381 aa
MDGPPSELMEPPLSQEIFSDLWNLLHENNVLTPAVSQTVNELLLPQGLANCLDKDPNEAS
STPATPAPAAALLAPGISWPLSSFVPSQKTYPGTYGFRLGFLNSGTAKSATCTYSPTLNK
LFCQLAKTCPVQLWVSSPPPLDTRVRAMAIYKKPEHMTEVVRRCPHHERCSDYSDGLAPP
QHLIRVEGNSGAQYLEDKITFRHSVVVPYKPPEVGSDCTTVRYNFMCNSSCLGGMNRRPI
LAIITLEDPNGNLLGRNSFEVRICACPGRDRRTEEENFRRKGEPCPKQPPGSTKRAPPTD
TDSSPPPKMPMDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKDPGGSKTHSSHLKSE
KGQSTSRRKKTMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggatgggccaccgtcagaactcatggagccccctctgagtcaggagatattttcagac
ttgtggaatctacttcatgaaaacaatgttctgacccccgcagtctcccagacagtgaat
gaactgctgctgccccaaggccttgcaaactgtctggacaaagatccaaatgaagcctcc
agtacaccagcaactcctgcaccagcagctgctctcctagcaccaggcatctcctggccc
ctgtcatcctttgtcccttcccagaagacctaccccggtacctatggtttccgtttagga
ttcctgaattctgggacagccaagtctgcaacctgcacgtactcccctaccctcaacaag
ctgttttgccagctggcaaagacctgccccgtgcagctgtgggtcagctccccacccccg
ctcgacacccgtgtccgtgccatggccatctacaagaagcctgagcacatgacagaggtt
gtgaggcgctgcccccaccatgagcgctgctctgactatagtgatggcctggcccctcct
cagcatctcatccgggtggaagggaattcgggtgcccagtatttggaggacaaaatcacg
tttcgacatagtgtggtggtgccctataagccgcccgaggtgggctcggactgtaccacc
gtccgctacaacttcatgtgtaacagctcctgcctggggggcatgaaccggcggcccatc
ctcgccatcatcacgctggaggaccccaatgggaatctgctgggacggaacagctttgaa
gtgcgtatttgcgcctgtcctgggagagaccggcgcacagaggaagaaaatttccgcagg
aagggggagccttgtcccaagcagccccctgggagcacgaagcgagcaccgcccaccgac
actgactcctctcccccgccaaagatgccaatggatggagaatacttcacacttcagatc
cgagggcgggagcgctttgagatgttccgagaattgaatgaagccttagagctaaaggat
gcccaggctggaaaggacccagggggaagcaagactcactccagccacctgaagtctgaa
aagggacaatctacctcccgccgtaaaaaaaccatgttcaagagagagggacctgactca
gactga

KEGG   Miniopterus natalensis: 107544572
Entry
107544572         CDS       T05883                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04071  Sphingolipid signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04137  Mitophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04216  Ferroptosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04722  Neurotrophin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544572 (TP53)
   04310 Wnt signaling pathway
    107544572 (TP53)
   04071 Sphingolipid signaling pathway
    107544572 (TP53)
   04151 PI3K-Akt signaling pathway
    107544572 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107544572 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    107544572 (TP53)
   04210 Apoptosis
    107544572 (TP53)
   04216 Ferroptosis
    107544572 (TP53)
   04115 p53 signaling pathway
    107544572 (TP53)
   04218 Cellular senescence
    107544572 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107544572 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107544572 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    107544572 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544572 (TP53)
   05202 Transcriptional misregulation in cancer
    107544572 (TP53)
   05206 MicroRNAs in cancer
    107544572 (TP53)
   05205 Proteoglycans in cancer
    107544572 (TP53)
   05203 Viral carcinogenesis
    107544572 (TP53)
   05230 Central carbon metabolism in cancer
    107544572 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107544572 (TP53)
   05212 Pancreatic cancer
    107544572 (TP53)
   05225 Hepatocellular carcinoma
    107544572 (TP53)
   05226 Gastric cancer
    107544572 (TP53)
   05214 Glioma
    107544572 (TP53)
   05216 Thyroid cancer
    107544572 (TP53)
   05220 Chronic myeloid leukemia
    107544572 (TP53)
   05217 Basal cell carcinoma
    107544572 (TP53)
   05218 Melanoma
    107544572 (TP53)
   05219 Bladder cancer
    107544572 (TP53)
   05215 Prostate cancer
    107544572 (TP53)
   05213 Endometrial cancer
    107544572 (TP53)
   05224 Breast cancer
    107544572 (TP53)
   05222 Small cell lung cancer
    107544572 (TP53)
   05223 Non-small cell lung cancer
    107544572 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107544572 (TP53)
   05014 Amyotrophic lateral sclerosis
    107544572 (TP53)
   05016 Huntington disease
    107544572 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107544572 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544572 (TP53)
   05161 Hepatitis B
    107544572 (TP53)
   05160 Hepatitis C
    107544572 (TP53)
   05162 Measles
    107544572 (TP53)
   05168 Herpes simplex virus 1 infection
    107544572 (TP53)
   05163 Human cytomegalovirus infection
    107544572 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544572 (TP53)
   05169 Epstein-Barr virus infection
    107544572 (TP53)
   05165 Human papillomavirus infection
    107544572 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107544572 (TP53)
   01522 Endocrine resistance
    107544572 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107544572 (TP53)
   03036 Chromosome and associated proteins [BR:mna03036]
    107544572 (TP53)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107544572 (TP53)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107544572 (TP53)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107544572 (TP53)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107544572 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 107544572
NCBI-ProteinID: XP_016077972
LinkDB
Position
Unknown
AA seq 381 aa
MDGPPSELMDPPLSQETFSDLWNLLHENNVLTPEVSPTVNELLLSPDLVNCLDKDPNEAS
SIPATPAPAAAPLAPGTSWPLSSFVPSQKTYPGTYGFRLGFLNSGTAKSVTCTYSPTLNK
LFCQLAKTCPVQLWVSSPPPLDTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSDGLAPP
QHLIRVEGNSGAEYLDDKITFRHSVVVPYKPPEVGSDCTTVHYNFMCNSSCMGGMNRRPI
LTIITLEDSNGNLLGRNSFEVRICACPGRDRRTEEENFRKKEEPCPKQPPGSTKRALSTN
TDSSHPPKMPMDEEYFTLQIRGRERFEMFRELNEALELKDAQAGKDPGGSKTHSSHLKSK
KGQSTSRHKKPMLKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggatgggccaccgtcagaactcatggatccccctctgagtcaggagacattttcagac
ttgtggaatctacttcatgaaaacaatgttctgacccccgaagtctccccgacagtgaat
gaactgctgctgtccccagaccttgtaaactgtctggacaaagatccaaatgaagcttcc
agtataccagcaactcctgcaccagcagctgctcccctagcaccaggcacctcctggccc
ctgtcatcctttgtcccttcccagaagacctaccctggtacctatggtttccgtttagga
ttcctgaattctgggacagccaaatctgtaacctgcacgtactcccctaccctcaacaag
ctgttttgccagctggcaaagacctgtcctgtgcagctgtgggtcagctccccacccccg
ctcgacacccgtgtccgtgccatggccatctataagaagtctgagtacatgacagaggtt
gtgaggcgctgcccccaccatgagcgctgctctgactatagtgatggtctggcccctcct
cagcatcttatccgggtggaagggaattcgggtgccgagtatttggacgacaaaatcact
tttcgacatagtgtggtggtgccctataagccgcccgaggtgggctctgactgcaccacc
gtccactacaacttcatgtgtaacagctcctgcatgggaggcatgaaccggcggcccatc
ctcaccatcatcacactggaagactccaatggtaatctgctgggacgaaacagctttgaa
gtgcgtatttgcgcctgtcccgggagagaccggcgcacagaggaagaaaatttccgcaag
aaggaggagccttgtcccaagcagccccctgggagcactaagcgagcactgtccaccaac
actgactcctctcacccgccaaagatgccaatggatgaagaatatttcacccttcagatc
cgtgggcgggagcgctttgagatgttccgagaattgaatgaagccttagagctaaaggat
gcccaggctggaaaggacccagggggaagcaagactcactccagccacctgaagtctaaa
aagggacaatctacctcccgccataaaaaacccatgctcaagagagagggacctgactca
gactga

DBGET integrated database retrieval system