KEGG   Miniopterus natalensis: 107538945
Entry
107538945         CDS       T05883                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Module
mna_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107538945
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107538945
   04927 Cortisol synthesis and secretion
    107538945
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107538945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107538945
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     107538945
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP21 family
   107538945
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107538945
NCBI-ProteinID: XP_016070787
LinkDB
Position
Unknown
AA seq 353 aa
MLLLGLLLLTLLAGARLLWGQWKLRSLHLPPLAPGFLHLLQPNLPIYLLGLAQKLGPIYR
LRLGLQNVVVLNSKRTIEEAMVKKWVDFAGRPQIPSYKLVSPCAQDLSLGDYSLLWKAHK
KLTRSALLLGMRSAMEPVVEQLTQKFCERMRAQAGAPVAIQKEFSFLTCSIICYLTFGEQ
EDTVVHLFHNCVQDLMKTWDHWSIQILDIVPFLRFFPNPGLWRLKQALENRDHIVEEQLR
QHKESMVAGRWRDMLDYMLQGVGEPSAEAGPGQLLEGHVHMSVVDLFIGGTETTSTTLSW
AVAFLLHHPEVQQRLQEELDRELGPGAWGPRVPYKDRARLPLLHATIAEVLRL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgttgctccttgggcttctgctactgaccctgctggccggcgcccgcctgctgtggggc
cagtggaagctcaggagcctccatctcccacctcttgcccctggcttcctgcacctgctg
cagcccaacctccccatttatctgcttggcctggctcagaaactggggcccatctacagg
ctccgcctggggctgcaaaacgtggtggtgctgaactctaagaggaccattgaggaggcc
atggtcaagaagtgggtggacttcgccggcagaccccagataccatcctacaagctggtg
tctccgtgtgcccaggacctctcactaggggactattccctgctctggaaggcccacaag
aagctcacccgctcggccctgctgttgggcatgcgcagcgccatggagcctgtggtggag
cagctgacccagaagttctgtgagcgcatgagagcccaggccggtgccccggtggccatc
cagaaggaattctcgttcctcacctgcagcatcatctgctacctcacctttggagagcag
gaagataccgtagtgcatctctttcacaactgtgtccaggacctgatgaaaacctgggac
cactggtccatccaaattttggacattgttccctttctcaggttcttccccaatcccggc
ctctggcggctgaagcaggctctggagaacagggaccacattgtggaggagcagctgcgg
cagcacaaggagagcatggtggcaggccgctggagggacatgctggactacatgctccag
ggcgtgggggagccgagcgccgaggcgggccctgggcagctcctcgaggggcacgtgcat
atgtctgtggtggaccttttcatcggtggcactgagaccacgtcgaccaccctctcctgg
gctgtggcgttcctgcttcaccaccctgaggttcagcagcgactgcaggaggagctggac
cgcgagctgggccccggggcctggggcccccgagtcccgtacaaggaccgcgcgcggctg
cccttgctccacgccaccatcgcggaggtgctgcgcctg

DBGET integrated database retrieval system