KEGG   Miniopterus natalensis: 107538974
Entry
107538974         CDS       T05883                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04064  NF-kappa B signaling pathway
mna04071  Sphingolipid signaling pathway
mna04150  mTOR signaling pathway
mna04210  Apoptosis
mna04217  Necroptosis
mna04350  TGF-beta signaling pathway
mna04380  Osteoclast differentiation
mna04612  Antigen processing and presentation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04640  Hematopoietic cell lineage
mna04650  Natural killer cell mediated cytotoxicity
mna04657  IL-17 signaling pathway
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04920  Adipocytokine signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04940  Type I diabetes mellitus
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05134  Legionellosis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05310  Asthma
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538974 (TNF)
   04350 TGF-beta signaling pathway
    107538974 (TNF)
   04064 NF-kappa B signaling pathway
    107538974 (TNF)
   04668 TNF signaling pathway
    107538974 (TNF)
   04071 Sphingolipid signaling pathway
    107538974 (TNF)
   04150 mTOR signaling pathway
    107538974 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107538974 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107538974 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107538974 (TNF)
   04217 Necroptosis
    107538974 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107538974 (TNF)
   04620 Toll-like receptor signaling pathway
    107538974 (TNF)
   04621 NOD-like receptor signaling pathway
    107538974 (TNF)
   04622 RIG-I-like receptor signaling pathway
    107538974 (TNF)
   04625 C-type lectin receptor signaling pathway
    107538974 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    107538974 (TNF)
   04612 Antigen processing and presentation
    107538974 (TNF)
   04660 T cell receptor signaling pathway
    107538974 (TNF)
   04657 IL-17 signaling pathway
    107538974 (TNF)
   04664 Fc epsilon RI signaling pathway
    107538974 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107538974 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107538974 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107538974 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538974 (TNF)
   05170 Human immunodeficiency virus 1 infection
    107538974 (TNF)
   05161 Hepatitis B
    107538974 (TNF)
   05160 Hepatitis C
    107538974 (TNF)
   05171 Coronavirus disease - COVID-19
    107538974 (TNF)
   05164 Influenza A
    107538974 (TNF)
   05168 Herpes simplex virus 1 infection
    107538974 (TNF)
   05163 Human cytomegalovirus infection
    107538974 (TNF)
   05169 Epstein-Barr virus infection
    107538974 (TNF)
   05165 Human papillomavirus infection
    107538974 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107538974 (TNF)
   05135 Yersinia infection
    107538974 (TNF)
   05133 Pertussis
    107538974 (TNF)
   05134 Legionellosis
    107538974 (TNF)
   05152 Tuberculosis
    107538974 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107538974 (TNF)
   05144 Malaria
    107538974 (TNF)
   05145 Toxoplasmosis
    107538974 (TNF)
   05140 Leishmaniasis
    107538974 (TNF)
   05142 Chagas disease
    107538974 (TNF)
   05143 African trypanosomiasis
    107538974 (TNF)
  09163 Immune disease
   05310 Asthma
    107538974 (TNF)
   05322 Systemic lupus erythematosus
    107538974 (TNF)
   05323 Rheumatoid arthritis
    107538974 (TNF)
   05321 Inflammatory bowel disease
    107538974 (TNF)
   05330 Allograft rejection
    107538974 (TNF)
   05332 Graft-versus-host disease
    107538974 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107538974 (TNF)
   05014 Amyotrophic lateral sclerosis
    107538974 (TNF)
   05020 Prion disease
    107538974 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    107538974 (TNF)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107538974 (TNF)
   05418 Fluid shear stress and atherosclerosis
    107538974 (TNF)
   05410 Hypertrophic cardiomyopathy
    107538974 (TNF)
   05414 Dilated cardiomyopathy
    107538974 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107538974 (TNF)
   04940 Type I diabetes mellitus
    107538974 (TNF)
   04932 Non-alcoholic fatty liver disease
    107538974 (TNF)
   04931 Insulin resistance
    107538974 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107538974 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107538974 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107538974 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107538974 (TNF)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Tumor necrosis fators
   107538974 (TNF)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107538974 (TNF)
SSDB
Motif
Pfam: TNF Form-deh_trans
Other DBs
NCBI-GeneID: 107538974
NCBI-ProteinID: XP_016070810
LinkDB
Position
Unknown
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATALFCLLHFGVIGPQR
EEVKRELQIHLPLARTLGLSSRTPSDKPVAHVVANQHAVGQLQWQNKIANALLTNGMRLI
DNQLVVPTDGLYLVYSQVLFKGQGCPQSHLLLTHTISRFAASYQDKVSLLSAIKSPCQRE
TPEGTEAKPWYEPVYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIVAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggctgaggaggcgctccccaagaag
gcagggggcccccagggctccaggcggtgcctgtgcctcagcctcttctccttcctcctc
gtggcaggagccaccgcgctcttctgcctgctgcacttcggggtgatcggcccccagagg
gaagaggtgaaaagagaactccagattcacctccccctggcccggaccctcggattatct
tctcgaaccccaagcgacaagcccgtcgcccatgttgtcgcaaaccagcacgccgtgggg
cagctgcagtggcagaacaagatcgccaacgctctcctgaccaacggcatgaggctgata
gacaaccagctggtggtgcccacggacggactgtacctggtctactcccaggtcctcttc
aagggccagggctgccctcagagccacctgctcctcacgcacaccatcagccgcttcgcc
gcttcctaccaggacaaggtcagcctcctctcggccatcaagagcccctgccagagggag
accccagaggggactgaggccaagccctggtacgagcccgtctacctgggaggggtcttc
cagctggagaaggacgatcggctcagcgctgagatcaacctgcctgactatctcgatttt
gccgagtccgggcaggtctactttgggatcgttgccctgtga

DBGET integrated database retrieval system