KEGG   Miniopterus natalensis: 107539491
Entry
107539491         CDS       T05883                                 

Gene name
TG
Definition
(RefSeq) thyroglobulin
  KO
K10809  thyroglobulin
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
mna05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107539491 (TG)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107539491 (TG)
SSDB
Motif
Pfam: COesterase Thyroglobulin_1 Ephrin_rec_like
Other DBs
NCBI-GeneID: 107539491
NCBI-ProteinID: XP_016071478
LinkDB
Position
Unknown
AA seq 2812 aa
MLDREIWLELELVLELGLVLELDLHPDLELELLLELELELELDLELLELRMALVLWALSL
LGSACLVSANIFEYQVDAQPLRPCELRRERALRRRADYVAQCAEDGRFQTIQCLKDGSSC
WCVSADGREVPGSRQPGRPVACLSFCQLHKQQILLSSYLNSTATSYLPQCQDSGEYMPVQ
CDLRREQCWCVDTEGMEVYGTRQLGRPTRCPESCEIRNRRLLHGVGDKSPPQCSPDGRFL
PVQCKFVNTTDMMVFDLVHNYNRFPDAFVTFSAFRRRFPEVSGYCHCADSQGRELAETGL
ELLLDEIYDTIFAGLDLAATFTQTTLYRILQRRFLAVQLVLSGRFRCPTKCEVERFTATN
FGHPYIPSCHRDGAYQAVQCQREGPCWCVDAQGREVRGTRRPDASLPCAGDQSCSSERRR
ALSRLHFGPLGDFSLHSMFSAWKGAGSAMSCPPMIKELFVDSGILRPMVEGRNQQFSTSE
SLLTEAIRGIFPSRDLARLALQFTTNPKQLQQNLFGGKFLANVGQFNLSGALGTRSTFNF
SQFFQQLGLPGLQNGGGHVDLSKPLSAGLDSNPAVETPRAIKKGSTMNKTIVGSFGFDIN
LQENQNALTSLASLLDLPEFLLFLQHAVSVPEDIARDLGDVMEMVLSSRGCEPTPGRLFV
PSCTAEGSYEDVQCFAGVCWCVDSQGKELPGSRVRGGQPRCPTECEKQRARMQSLSGSQP
AGSSLFVPSCTSQGHFLPVQCFNSECYCVDAEGQVIPGTRSVPGQPKQCPTPCQLQAEQA
FLQVVRTLVSNSSMAPTLSSVYIPQCSTNGQWSRMQCDGPPEQAFEWYEGWRAQNDGGRE
LTAAELLMKILSYREAASRSFSLFIQSLYEAGQQGIFPGLARYSSLQDVPLAVLEGNWTQ
PGKNVFLEPYVFWQILNGQLRRYPGPYSDFSTPLAHFDLRTCWCVDEAGQELEGTRTEPG
KVPACPGSCEEAKLRVLRFIKDTEEMVLASNNSWFPLGESFLAAKGIQLTNEELGLPPLA
PPRGAFLEQFLSGSDYALRLAAQSTFDFYQSGRFSLADSSGASPLRSSSYVPQCDAFGSW
EPVQCHTETGYCWCVGKTGDYVPASLTARSSQLPQCPTTCEKSRASGLLSSWKQAGSQGD
PSPKDLFIPTCLQTGEFARLQVSEAGIWCVDQASGEGTPPSTNSSAQCPGLCESLQSGIP
SRRLGPGYTPACEAEDGSLSPVQCDPTQDSCWCVFGSGEEVPGTRVAGSRPACESPQCPL
PFNVSDVTGGVILCERASGPRGATVQLCQLLCRQGYQSAFRPMSLVCSLETRRWLSQPPQ
PLACQRLQLWQTLQTQAQFQLRLPPGKMCSADYSGLLLAFQVFISDELRARGFCQVQVKL
SGTPVSVPVCDDSVVQVECLTAERLGVNVTWKLRLEDVPPASLPDLHDVEEALVGKDLVG
RFADLVQSGMFQFHLDSKTFLADTSIHFLQGDSFGPSPRTRYGCLEGFHPVAAPSNASQD
PLGCVKCPEGSYFQDEQCVPCPAGFYQEWAGSLTCTPCPVGRTTASEGAFSQTHCVTDCQ
RNEAGLQCDQDGQYRASQMDRDSGRAFCVDNEGRRLPWSEMEAPLTDSQCLMMQKFEKAP
EPQVIFDASAAEGVRSQVPGSESPLKQCLADCALDQACSFLTVSTVGSEVSCEFYAWTSD
NIACTVSGQDQDAAGNSKATGFGSLRCQVKVRSGGQDSPAVYLKKGQEFSTRSQKSFEPT
GFQNVLSGMYSPAVFPGSGTNRTEVHLFCLLSCDRDTCCDGFVLTQVQGGPIICGLLSSP
DVLLCHVNDWRDPSKAKANATCPGVTYDQGSRQVTLQLGGQEFKSWTPLEGTQDTLTSFQ
QVYLWKDSDMGSRSESMGCGRDTEPRASPPPETDLTTELFSPVDLEQVVVRGNRSLPSQQ
HWLFKHLFSAQQANVWCLSRCVQEPSFCQLAEIRDSAPLYFTCTLYPEAQVCDDVLESRP
TGCRLILPHRPSALFRKKGVLKDKVKSFYTRLPFQKLAGVSVRSKAPMPDKAISDGFFEC
ERLCDVDPCCSGFGFLNVSQLKGGEVTCLTLNSLGLQTCSEESGGTWRILDCGSSDIEVR
TYPFGWYQKPVAQNDPPSFCPPVVLPSLSEKVPLDSWQTLALSSAVVDPSIRDFDVAHIS
MAATSDFSAARDLCLLECSRHQACQVTTLQTRPGTLRCVFYADTQICTHSLQAQYCQLLL
REEATHIYWKLNIPLLGLGTSAPSVTIAPHGRLLGRSQAVQVGTSWKQVDQFLGVPFAAP
PLAESRFGAPEPLNWTGPWAATAPRASCWQPGIATPASSRVSEDCLYLNVFVPQSVTPNA
SVLVFFHNTMATRDGEGGLALDGSFLAAIGNLIVVTAGYRVGIFGFLSSGSGEVSGNWGL
LDQVAVLTWVQTHIRVFGGDPRRVTMAADRGGADVASIHLLTFGAGGSRLFRRAVLMGGS
ALSPAAVISRERAQQQAAALSKEVSCPTSSIQEMISCLRQKPASILNDAQTKLLAVSGPF
HYWGPVIDGQYLREAPARALQRVPQGEVDLLIGSSQDDGLISRAKAVKQFEESQGRTSSK
TAFYRALQNSLGGEDATEGVRAAATWYYSLEHSADDYASFSRALEAAARDYFITCPVIDM
ASQWARRARGNVFMYHAPQSYGHGSLDLLTDVQYAFGLPLHPAYEGQFTQEEKSTSLKVL
QYFSNFIRSGNPNYPHEFSRKVPEFAVPWPDFVPGADGENYKEFSALLPNRRGLKKADCS
FWSKYIRSLKAPADEAKDELSAANEEDDQPAGSGLREELLGLPDPGPKSYSK
NT seq 8439 nt   +upstreamnt  +downstreamnt
atgcttgacagagagatctggctggagctggagctggttctggagctggggctggtgctg
gagttggacctgcacccggacctagagctagagctgctgctggagctggagctggagctg
gagctggacctggagctgttggagctaagaatggcgctggtcctgtgggccctcagtctg
ctgggctcagcctgcctggtgtcagccaacatctttgagtaccaggtggacgcccagccc
ctgcgcccctgcgagctgcggcgggaaagggcccttcggcggcgagcggactacgtggcc
cagtgcgccgaggacggccgcttccagactatccagtgcctgaaggatggcagctcttgc
tggtgtgtgtctgccgacggcagggaggtgcctggcagcaggcagcctgggcggcctgtg
gcatgtctgtctttctgccaactgcacaagcagcaaatcctgctgagcagctacctcaac
agcacggccacctcctacctccctcagtgtcaagactcgggggagtacatgcccgtgcag
tgtgacctgcggcgggagcagtgctggtgtgtggacacggaggggatggaggtgtacggg
acccgccagctgggcaggcccacgagatgtccagagagctgtgagataagaaaccgccgc
cttctccacggggtgggggacaagtctccaccccagtgttctccggatggcaggtttctg
cctgtccagtgcaagtttgtcaacaccactgacatgatggttttcgacctggtccacaac
tacaacaggtttccagatgcattcgtgacgttcagcgccttccggagaaggttccctgag
gtgtccgggtactgtcactgtgccgacagccaggggcgggaactggctgagacaggtttg
gagctgctgctcgatgaaatttacgacaccattttcgctggcctggacctcgctgccacc
ttcacgcagaccaccctgtaccggatactgcagagacgcttcctagcggttcagctagtc
ctttcgggcagattccgatgccccacaaaatgtgaggtggagcggtttacagcgaccaac
ttcggtcacccctacattccgagctgccaccgagatggggcctaccaggcggtgcagtgc
cagagggaagggccgtgctggtgtgtggatgcccagggcagggaggtccgcggaactcgg
aggccggacgcgtcgctgccttgtgctggagaccagtcctgttcctccgagaggcgacgg
gccctgtccagactccacttcgggcccttgggcgacttcagcctccacagcatgttttcg
gcttggaaaggagccggatcagccatgtcctgcccacccatgatcaaagagctctttgtg
gactcagggattctccgccccatggtcgaagggcggaaccaacagttttccacctcagag
agtctcctcacagaagccatccgagggatttttccctcccgagacttagctcgtcttgcc
cttcagtttaccaccaacccaaagcagctccagcaaaacctctttggagggaaatttttg
gcaaatgttggccaatttaacttgtctggagcccttggcacaagaagcacctttaatttc
agtcagtttttccagcaacttggtctcccaggcttgcagaatggaggaggacatgtcgat
ctatcaaagcccctctctgcagggctggattcgaatcctgccgtggaaacacccagagcc
attaagaagggcagtactatgaataaaacaattgtgggcagctttggctttgacatcaac
ttacaagagaaccaaaatgccctgacatctcttgcttctctcctggaccttccagaattc
cttctgttcctgcaacatgcggtttcagtgccagaagacatagccagggatttgggtgat
gtgatggaaatggtgctcagttcccggggctgtgagccaacacctggcagactttttgtc
ccgtcctgcacggcagaaggaagctatgaggatgtccagtgctttgctggagtgtgctgg
tgtgtggactcccagggcaaagaactgcctggctcgagggtgagaggtggacaaccaagg
tgccccacagagtgtgaaaagcaaagggctcggatgcagagcctctctggcagccagcct
gcaggctccagtctgtttgtgccttcttgtaccagccaggggcacttcttacctgtccag
tgcttcaactctgagtgctactgtgtagatgcggagggccaggttattcctggaactcga
agtgtacctggacaacccaagcagtgccccacaccttgtcagttacaggccgaacaagcc
ttcctccaagtggtacggaccctggtctctaattctagcatggcgcccactctctccagt
gtctacatcccacagtgcagcaccaacgggcagtggagccgcatgcaatgtgatgggccc
ccggagcaggccttcgagtggtacgaagggtggagggctcagaacgacggtggccgggag
ctaaccgctgctgaactgctgatgaagatcctgagctacagagaagcagcttccagaagc
ttcagtctctttattcaaagtctgtatgaggctggccagcaaggcatcttcccagggttg
gcaagatactcttctctccaagacgtcccactggccgtgttggaagggaactggacccag
ccaggaaagaatgtcttcctggagccctatgtcttttggcagatcctaaatggccagctc
aggcgatacccagggccctattcagactttagcacccctttggcgcactttgacctccgg
acttgctggtgtgtggatgaagctggtcaagaactagagggaacccggactgagccaggc
aaggtcccagcatgtcctggctcctgcgaggaagcaaagcttcgtgttctgcggttcatt
aaggacacggaagagatggtcttggcttccaacaactcttggttccctctgggagagagt
ttcctagcggccaaggggatccagctgaccaatgaggagctcggccttcccccgctcgcc
ccaccccggggggctttcttggagcagttcctgagcgggagcgattatgcccttcgtctg
gcagctcagtccaccttcgacttctatcagagtggccgattctccctggctgattcctca
ggagcgtcccctctgcggtctagctcctatgtgccccagtgtgatgcatttggaagttgg
gagcctgtgcagtgccacactgaaactgggtactgctggtgtgtgggtaagacgggagac
tacgtccctgcctcgctgactgcgcgctcctcccagctcccccagtgccccaccacctgt
gagaaatctcgagcgagtggactgctttccagttggaaacaggctggatcccaaggagac
ccttcccctaaagacctgttcatcccaacctgcctacagacaggagagtttgccaggctg
caggtgtcggaggctggcatctggtgcgtagaccaggcctcaggagaagggaccccgccc
agcacaaacagcagtgcccagtgcccaggcctctgtgaatcactccagagcggcatcccc
tccaggaggctgggcccaggctacaccccggcctgcgaggcagaggacggtagcctttcc
cccgtgcagtgcgacccgacccaggacagctgctggtgtgtctttggaagtggagaggag
gtgcctgggacccgtgtggcagggagccggccggcctgtgagagcccgcagtgcccactg
ccattcaacgtgtcagatgtgactggtggagtgatcctgtgtgagcgagcctcgggccct
cgaggggccaccgtccagctgtgccagctgctgtgccgccagggctaccagagcgcgttc
cggccaatgtcattggtgtgcagcctggagacgagacgctggctgtcacagccaccccag
cccctggcctgccagcggctccagctgtggcagaccctccagacccaagcacagttccag
ctccggctcccaccaggcaagatgtgcagtgcagactactcgggcctgctgctggccttc
caggtcttcatctcagacgagctcagggcccggggcttctgccaggtccaggtgaagctt
tccgggacccctgtctctgttcctgtctgcgacgactccgtggtgcaggtggagtgtctg
accgcggagcgtttaggagtgaatgtcacgtggaaattgcggcttgaggatgtcccaccg
gcctctcttcctgatttgcatgacgttgaggaagccttagtgggcaaggacctcgttggg
cgcttcgcagatctggtccaaagtggcatgttccagtttcacctggattccaagacgttc
ctagcagacacctccatccacttcctccagggggacagctttggcccctctcccaggaca
cgatacgggtgcttggaaggattccatcccgtcgcggcccccagcaacgccagtcaggac
ccactggggtgcgttaagtgtcctgaaggaagctattttcaggacgagcaatgtgttccc
tgtcccgctggattctaccaagagtgggcggggagcttgacctgcaccccgtgtcctgtg
ggcagaacgaccgcgtccgagggagctttcagtcagactcactgtgtcactgactgccag
aggaatgaggcaggcctacagtgtgaccaggatggccagtaccgagccagccagatggac
agggacagtgggagggccttctgtgtggacaacgaggggcggaggctgccatggtccgaa
atggaggccccactcacggactcccagtgtctgatgatgcagaaatttgagaaggcccca
gaacctcaggtgatctttgatgcctccgctgccgagggagtgaggtcccaagttcctggc
tctgagtcgcccctgaagcagtgcttggcagactgtgccttggatcaggcctgcagcttc
ctcacagtgtccacggtgggatcagaagtctcctgtgaattctatgcttggacaagtgac
aatatcgcctgcacagtttctggtcaggatcaagatgcagcggggaactccaaggccacg
ggctttgggagcctcaggtgccaggtgaaagtgaggagcgggggtcaggactctccggcc
gtgtatctgaagaagggccaagaattcagcacaagaagtcagaaaagctttgaaccaact
ggtttccaaaatgtgctttctggaatgtacagccccgccgtgttcccaggctcgggaacc
aaccggacagaggtccatctcttctgcctcctctcatgtgaccgggacacatgctgcgac
ggcttcgtcctcacgcaagtccaaggaggtcccatcatctgtggcttgctgagctcccct
gacgtcctgctttgccacgtcaatgactggagggacccctccaaagccaaggcaaatgct
acatgtcctggtgtgacctacgaccaggggagccgccaggtgacactgcaactgggaggc
caggagttcaagagttggacgcccctggaagggactcaggacaccttgaccagtttccag
caggtttatctctggaaagattctgacatggggtctcggtctgagtctatgggatgtgga
agagacacggaaccaagggcatcgcctccaccagaaacagatttgacaacagagctgttc
tcccctgtggaccttgagcaggttgtggtccgtgggaaccggtccctgcccagccagcag
cactggctgttcaaacaccttttctcagctcagcaagcgaatgtgtggtgcctttctcgc
tgtgtccaggagccctctttctgtcaactggcagagataagagacagcgcccccttgtac
ttcacctgcaccctctacccagaggcccaggtgtgtgatgatgtcctggagtcacgtccc
acgggctgcagactgatcctgccccacagaccgagtgccctgttccggaagaaaggtgtg
cttaaggataaagtgaagagcttctacacccgcctgccattccagaagctggcgggggtc
tccgtgagaagcaaagcgcccatgcccgacaaggccatctctgacgggttcttcgagtgt
gaacgcttgtgcgacgtggacccgtgctgctccggcttcggctttctaaatgtttcccag
ttgaaaggtggagaggtgacatgcctaactctgaacagcttaggacttcagacctgcagt
gaggaaagtggaggaacctggcgcattttggactgtggctcttctgacattgaggtccgc
acctatcccttcggatggtaccaaaagccagttgctcaaaatgaccctcctagtttttgc
cctccagtggttctgccttccctctcagagaaagtccctctagactcatggcagaccctg
gccctctcctcagcagtcgttgacccgtccatcagggacttcgatgttgcccacatcagc
atggctgccaccagcgacttctcagctgcccgagacctctgcttgttggagtgttcccgt
caccaagcctgccaggtcaccactttgcagacccgacctggtactctgaggtgtgtgttc
tatgctgatacccagatctgcacacatagcctgcaggcccagtactgccaacttctgctc
cgtgaagaggccacccacatctactggaagctgaacatccctctgctcggcttggggaca
tctgcaccttctgtgaccatcgcgccccatggccggctgctgggcaggtcccaggccgtc
caggtgggcacttcatggaagcaagtggaccagttcctgggggtgccctttgctgccccg
cccctggccgagagccgcttcggggctccggagcccttgaactggacggggccctgggct
gccaccgcgccacgggccagctgctggcagccagggatcgcaacacccgcgtcttcccga
gtcagcgaggactgcttgtatctcaacgtgtttgtccctcagagcgtgacccccaatgca
tcagtcctggtgttcttccacaacaccatggcaacccgggatggtgaagggggcctggcc
ctcgacggctccttcctggctgctattggcaacctcattgtggtcactgctggctaccga
gtgggcatcttcggcttcctgagctctgggtccggcgaggtgagtggcaactgggggctt
ctggaccaggtggcagttctgacctgggtgcagacccacatcagggtgtttggcggggac
cctcgacgagtgaccatggcagccgaccgtggcggagctgacgtggccagcatccacctt
ctaaccttcggggctggtggctccagactcttccggagggccgtgctgatgggtggctct
gcactgtcccccgccgctgtcatcagccgggagagggctcagcagcaggcagctgctttg
tcaaaggaggtcagctgccccacctcgtccatccaagaaatgatatcctgcctccgtcag
aagcccgccagcatcctcaatgacgcccagaccaagctcctggctgtgagtggccccttc
cactactggggtcctgtgattgacggccagtacctgcgagaggctcccgccagagcgctg
cagagggtcccgcagggcgaggtcgatctgctcatcggcagttctcaggatgacgggctc
atcagcagggcgaaggccgtgaagcaatttgaggaaagtcaaggccggaccagtagcaaa
acagccttttaccgggcgctgcagaactcactgggcggcgaggacgccaccgagggcgtg
cgggccgccgccacctggtactactccctggagcactcggccgacgactacgcctccttc
tcgcgggccctggaggccgccgcccgggactacttcatcacctgcccagtgattgacatg
gccagccagtgggcaaggagggcccgaggaaacgtgttcatgtaccacgctccccagagt
tatggccatggcagcctggacttgctgaccgatgtccagtatgcctttgggctgcccttg
caccctgcctacgagggccagtttacccaggaggagaaaagcacgtccctgaaagtcctg
cagtacttttccaacttcatccgctcaggaaatcccaactaccctcatgagttctcgagg
aaagtgcctgaatttgcagtcccctggcctgactttgtccctggtgctgacggagagaac
tacaaggagttcagtgccctgctccccaatcgacggggcctgaaaaaggccgactgctca
ttctggtccaagtacatccggtccctgaaggcacctgcagatgaagccaaggatgagctg
tcagcagcgaatgaagaggatgaccagccggctggctctggcctgagagaagagctcctg
ggcctcccagatccaggccccaagagctacagcaagtga

DBGET integrated database retrieval system