KEGG   Miniopterus natalensis: 107539508
Entry
107539508         CDS       T05883                                 

Definition
(RefSeq) fatty acid-binding protein, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
mna  Miniopterus natalensis
Pathway
mna03320  PPAR signaling pathway
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107539508
   03320 PPAR signaling pathway
    107539508
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 107539508
NCBI-ProteinID: XP_016071491
LinkDB
Position
Unknown
AA seq 132 aa
MCDAFVGTWKMVSSENFDDYMKEVGVGFATRKVAGMAKPNMTVIVNGDVITIKSESTFKN
TEISFKLGQEFDEVTADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRVDDKLVVECTM
KGVTATRVYERA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgtgatgctttcgtaggcacctggaaaatggtctccagcgaaaacttcgatgattac
atgaaagaagtgggagtgggctttgccaccaggaaagtggccggcatggccaagcccaac
atgactgtcattgtcaatggggatgtgatcaccatcaaatcagaaagcacctttaaaaac
acggagatctccttcaaactgggccaggaatttgacgaagtcactgcagatgacaggaaa
gtcaagagcatcatcaccttagacggaggtgccctggtacaggtgcagaaatgggatggg
aagtcaaccaccatcaagagaaagcgagtggatgataagctggtggtggaatgtaccatg
aaaggcgtcactgctaccagagtttacgagcgagcataa

DBGET integrated database retrieval system