KEGG   Miniopterus natalensis: 107539779
Entry
107539779         CDS       T05883                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107539779
   00565 Ether lipid metabolism
    107539779
   00590 Arachidonic acid metabolism
    107539779
   00591 Linoleic acid metabolism
    107539779
   00592 alpha-Linolenic acid metabolism
    107539779
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107539779
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107539779
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107539779
    3.1.1.32  phospholipase A1
     107539779
SSDB
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 Peptidase_C97
Other DBs
NCBI-GeneID: 107539779
NCBI-ProteinID: XP_016071838
LinkDB
Position
Unknown
AA seq 166 aa
MALPQVNPRPGDLIEIFRFGYAHWALYVGNGYVVHLAPPSEIAGAGAASIMSALADKAIV
KKELLCSVAGKDKYQVNNKHDKKYAPLPPSKIVRRAEELVGQEMVYKLTSDNCEHFVNEL
RYGVSRSDQVTDAVVAVGISAGIIGVGLVIAGLIGSLLDRGKQEKQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctttgccacaggtcaacccaagacctggggacctgattgagattttccgctttggc
tacgctcactgggccctctatgtgggaaacggctacgtggtccatctggctcctccaagt
gaaatcgcaggagctggtgcggccagcatcatgtccgccctcgccgacaaggccatagtg
aagaaggagctgctctgttctgtggccgggaaggacaagtaccaagtcaataacaaacac
gacaagaagtatgcgccgctgccgcccagcaaaatcgtccggcgggcggaggagctggtg
gggcaggagatggtctataagctgacgagcgacaactgtgagcactttgtgaacgagctg
cgctatggagtctcccgcagtgaccaggtcacagatgcggtggtggcagtaggcatttca
gcaggcatcataggggtgggcctggtcatcgcaggcctcattggatcgctgctggacaga
ggcaagcaggaaaagcagtaa

KEGG   Miniopterus natalensis: 107539806
Entry
107539806         CDS       T05883                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107539806
   00565 Ether lipid metabolism
    107539806
   00590 Arachidonic acid metabolism
    107539806
   00591 Linoleic acid metabolism
    107539806
   00592 alpha-Linolenic acid metabolism
    107539806
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107539806
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107539806
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107539806
    3.1.1.32  phospholipase A1
     107539806
SSDB
Motif
Pfam: LRAT Calici_PP_N
Other DBs
NCBI-GeneID: 107539806
NCBI-ProteinID: XP_016071882
LinkDB
Position
Unknown
AA seq 162 aa
MLAPIPEPNPGDLIEIFRPLYRHWAIYVGDGYVVHLAPPSEIAGAGAASIMSALADKAIV
KKELLCSVAGKDKYQVNNKHDKKYVPLPPSKIVRRAEELVGQEMLYKLTSDNCEHFVNEL
RYGVPRSDQVRDAIVAVGIAGVGLAAAGLIGAMISRNKRQKQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgctggcgcccattccagagcccaatcctggagacctgattgagattttccgccccctc
tacagacactgggccatctacgttggtgatggatatgtggtccacctggccccaccaagt
gaaatcgcaggagctggtgcggccagcatcatgtccgccctcgccgacaaggccatagtg
aagaaggagctgctctgttctgtggccgggaaggacaagtaccaagtcaataacaaacac
gacaagaagtatgtgccgctgccgcccagcaaaatcgtccggcgggcggaggagctggtg
gggcaggagatgctctacaagctgacgagcgacaactgtgagcacttcgtgaacgagctg
cgctatggagtcccccgcagcgaccaggtcagagatgccatcgtggcagttggcatcgca
ggtgtgggcttggcagctgccggcctcattggagccatgatctcaagaaacaagcgacaa
aagcaatga

DBGET integrated database retrieval system