KEGG   Miniopterus natalensis: 107539805
Entry
107539805         CDS       T05883                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04140  Autophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05165  Human papillomavirus infection
mna05168  Herpes simplex virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107539805 (BAD)
   04014 Ras signaling pathway
    107539805 (BAD)
   04370 VEGF signaling pathway
    107539805 (BAD)
   04024 cAMP signaling pathway
    107539805 (BAD)
   04022 cGMP-PKG signaling pathway
    107539805 (BAD)
   04151 PI3K-Akt signaling pathway
    107539805 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107539805 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    107539805 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107539805 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107539805 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107539805 (BAD)
   04919 Thyroid hormone signaling pathway
    107539805 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107539805 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539805 (BAD)
   05203 Viral carcinogenesis
    107539805 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107539805 (BAD)
   05212 Pancreatic cancer
    107539805 (BAD)
   05225 Hepatocellular carcinoma
    107539805 (BAD)
   05221 Acute myeloid leukemia
    107539805 (BAD)
   05220 Chronic myeloid leukemia
    107539805 (BAD)
   05218 Melanoma
    107539805 (BAD)
   05211 Renal cell carcinoma
    107539805 (BAD)
   05215 Prostate cancer
    107539805 (BAD)
   05213 Endometrial cancer
    107539805 (BAD)
   05223 Non-small cell lung cancer
    107539805 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107539805 (BAD)
   05014 Amyotrophic lateral sclerosis
    107539805 (BAD)
   05020 Prion disease
    107539805 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    107539805 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107539805 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107539805 (BAD)
   05161 Hepatitis B
    107539805 (BAD)
   05160 Hepatitis C
    107539805 (BAD)
   05162 Measles
    107539805 (BAD)
   05168 Herpes simplex virus 1 infection
    107539805 (BAD)
   05165 Human papillomavirus infection
    107539805 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107539805 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107539805 (BAD)
   01524 Platinum drug resistance
    107539805 (BAD)
   01522 Endocrine resistance
    107539805 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 107539805
NCBI-ProteinID: XP_016071881
LinkDB
Position
Unknown
AA seq 167 aa
MFQISEFEQSEQEDSSPADRGLGPSPTGDQHPGPSKHWSTVPGLLGEAGHQQGQPASSSH
HGGAGSAESRSRHSSYPTGSEEDDGNEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FQGSFKGLPRPKSASTTTQMRQNSSWTRFFQSWWDRNLGRGGPTSSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatctcagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggaccagcacccaggccccagcaagcactggagtacg
gtcccaggcctcctgggggaagctggtcaccagcaaggccagccggccagcagcagccac
catggaggcgctgggtctgcggagtcccggagtcgccacagctcgtaccccacggggagc
gaggaggatgacgggaacgaggaggagctcagccccttccgcggccgctcgcgttcagcg
ccccccaacctctgggctgcacagcgctatggccgtgagctccggaggatgagcgatgaa
ttccagggttcctttaagggacttcctcgcccaaagagcgcgagcacaacaacgcagatg
cggcaaaactccagctggacgcgcttcttccagtcctggtgggatcgaaacctggggaga
ggaggccccacctcctcccagtga

DBGET integrated database retrieval system