KEGG   Miniopterus natalensis: 107539908
Entry
107539908         CDS       T05883                                 

Gene name
KCNQ1
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04725  Cholinergic synapse
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107539908 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    107539908 (KCNQ1)
   04972 Pancreatic secretion
    107539908 (KCNQ1)
   04974 Protein digestion and absorption
    107539908 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    107539908 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107539908 (KCNQ1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107539908 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP
Other DBs
NCBI-GeneID: 107539908
NCBI-ProteinID: XP_016072000
LinkDB
Position
Unknown
AA seq 570 aa
MGPCGPGAATHSIVSSWDCGWHGECFLIVLVCLIFSVLSTIEQYVALATGTLFWMEIVLV
VFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFAT
SAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAE
KDAVNEAGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPA
GILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARGHA
LLSPSPKPKKSAMVKKKKFKLDKDNGVSPGEKMLTVPHITYDPVSEERRLDHFSVDSYEG
SVKKRPTVLEVSATHFTRTNSFTEDLDLEGETLLTPITHVSQLREHHRATIRVIRRMQYF
VAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDR
GSNTIGARLGRLEDKVTQLDQRLILITDMLHQLLSLHQSGPPGGRPPSGGGAHLVQPCRG
PIDPELFLPSNALPTYEQLTVPHRGPDEGS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggccctgtggccctggggctgccacccactccatcgtgagcagctgggactgtggc
tggcacggggaatgcttcctcatcgtcctggtgtgcctcatcttcagtgtgctgtccacc
atcgagcagtacgtcgccctggccacggggaccctcttctggatggagattgtcctggtc
gtgttcttcgggacagagtatgtggtccgcctctggtcagccggctgccgcagcaagtac
gtgggcatctgggggcggctgcgctttgcccggaagcccatttccatcatcgacctcatc
gtggttgtggcctccatggttgtcctctgcgtgggatccaaagggcaggtgtttgccacc
tcggccatcaggggcatccgcttcctgcagatcctgcggatgctgcacgtggaccgccag
ggcggcacctggaggctgctgggctccgtggtcttcatccaccgccaggagctgatcacc
accctgtacattggcttcctgggcctgatcttctcttcttacttcgtgtacttggccgag
aaggacgccgtgaacgaggctggacgcgtcgagtttggcagctatgcggacgccctgtgg
tggggagtggtcacggtcaccaccatcggctacggggacaaggtgccccagacgtgggtc
gggaagaccatcgcctcttgcttctccgtgttcgccatctccttctttgcgctcccggcg
gggatcctgggctccgggttcgccctgaaggtccagcagaagcagcggcagaagcatttc
aaccggcagatccccgcggcggcctcgctcatccagacggcatggaggtgctatgccgcc
gagaaccctgactcggccacctggaaaatctacgtgcggaagccagcccggggccacgct
ctgctctcccccagccccaagcccaagaaatctgccatggtaaagaaaaaaaagttcaaa
ctggacaaagacaacggggtgagtccgggcgagaagatgctcaccgtcccccacatcacc
tacgaccccgtctcggaggagcggaggctggaccacttctcggtggacagctacgagggt
tctgtgaagaaacgccccacggtgctggaggtgagcgccacccacttcacgaggaccaac
agcttcactgaggacctggacctggagggggagacactgctgacccccatcacccacgtg
tcgcagctgcgggagcaccaccgggccaccatccgggtcattcggcgcatgcagtacttc
gtggccaagaagaaattccagcaagcgcggaagccctacgacgtgcgggacgtcatcgag
caatactcgcagggccacctcaacctcatggtgcgcatcaaagagctgcagagaaggctg
gaccaatccatcgggaagccctccctcttcatctccgtctcagaaaagagcaaggaccgc
ggcagcaataccatcggcgcccgcctgggccggctggaagacaaggtgacacagctggac
cagcggctgattctcatcacagacatgctccaccagcttctctctctgcaccagagcggc
ccccccggcggccggccccccagcggaggtggcgcccacctggtccagccctgccgaggc
cccatcgaccccgagctcttcctgcccagcaatgcactgcccacctacgaacagctgacc
gtgccccacaggggccccgacgaggggtcctga

KEGG   Miniopterus natalensis: 107541267
Entry
107541267         CDS       T05883                                 

Gene name
KCNE1
Definition
(RefSeq) potassium voltage-gated channel subfamily E member 1
  KO
K04894  potassium voltage-gated channel Isk-related subfamily E member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107541267 (KCNE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541267 (KCNE1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107541267 (KCNE1)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 107541267
NCBI-ProteinID: XP_016073774
LinkDB
Position
Unknown
AA seq 129 aa
MSPSNTTAATPLLTSLWQESIQLGGNSSSLARRVPGSSNGEMEALYILMVLGFFGFFTLG
IMLSYIRSKKLEHSHDPFNVYIESDTWQEKDKAYLQARVLESYRACYVIENQLAVERPNA
YLPETKHSS
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagcccttctaacactacggccgcgacgcccctcctgaccagtctgtggcaggagtcc
attcagctgggcggcaactcgtccagcctggcccgcagggtgcccggcagcagtaacggc
gagatggaggccctctacatcctcatggtgctcggcttctttggcttcttcacgctgggc
atcatgctgagttacatccgctccaagaagctcgagcactcccacgaccccttcaacgtg
tacatcgagtcggacacctggcaggagaaagacaaggcctacctgcaggcccgggttctg
gagagctacagggcctgctacgtcattgaaaaccagctggccgtggagcgacccaacgcg
tacctccccgagacgaagcattcatcatga

DBGET integrated database retrieval system