KEGG   Miniopterus natalensis: 107540015
Entry
107540015         CDS       T05883                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04919  Thyroid hormone signaling pathway
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107540015 (SLC9A1)
   04024 cAMP signaling pathway
    107540015 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107540015 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107540015 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107540015 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    107540015 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    107540015 (SLC9A1)
   04971 Gastric acid secretion
    107540015 (SLC9A1)
   04972 Pancreatic secretion
    107540015 (SLC9A1)
   04976 Bile secretion
    107540015 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107540015 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107540015 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107540015 (SLC9A1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107540015 (SLC9A1)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   107540015 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 107540015
NCBI-ProteinID: XP_016072167
LinkDB
Position
Unknown
AA seq 834 aa
MLLWSGTCGPSPPRVSPSLLVVVALVGLLPVLRSHGLQLSPTASTIRGSEPPRERSIGDV
TTAPPELAPESRPVNHSVTEHGTKTRKPFPVLGIDYKHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFXGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQIN
NIGLLENLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEF
ASYDRVGIVDIVLGFLSFFVVSLGGVFVGVVYGVITAFTSRFTSHIRVIEPLFVFLYSYM
AYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGV
STVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGA
IAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINE
EIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKM
EMKQAIELVESGGMGKIPSAVSTVSMQNIHPKSLPADRILPALSKDKEEEIRKILRNNLQ
KTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKVRRLEQKINNYLTVPAHKLDSPTMSRAR
IGSDPLAYEPKADLPVITIDPASPQSPESVDLVNEELKGKVLGLNRSPRVTEEEEDDDGG
IVIRTKEPSSPGTDDVFTPGPSDSPSSQRIQRCLSDPGPHPEPEEGEPFIPKGQ
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgcttctgtggtctggcacgtgcggtccctctcctcctcgagtctccccttcgttgctc
gtggtagtagccttggtggggctactgcctgttctcaggagccatggcctgcagctcagc
cctactgccagcaccatcagaggctcagagccgccacgggaacgctcaattggggatgtc
accaccgccccaccagagcttgcccctgagagccgccctgttaaccattcagtcactgaa
catggcacgaagactcgaaagccctttccagtcctgggcatcgactacaaacacgtgcgc
acacccttcgagatctctctctggatcctgctggcctgcctcatgaagataggtttccat
gtgattcccactatttcgagtatcgtcccggagagctgcctgctgatcgtggtggggctg
ctggtagggggcctgatcaagggtgtgggtgagacaccccccttcctgcagtcggacgtc
ttcttccttttcctgctgccacccatcatcctggacgccggctacttcctgccgctgcgg
cagttcacagagaaccttggcaccatcctgatcttcnccgggtacttcctgccgctgcgg
cagttcacagagaacctgggcaccatcctgatctttgctgtggtgggcacgctgtggaac
gccttcttcctgggcggcctcatgtatgccgtgtgcctggtgggtggcgagcagatcaac
aacatcggcctcctggaaaacctgctcttcggcagcatcatctcggctgtggaccccgtg
gccgtgctggctgtctttgaggaaattcacatcaacgagctgctacatatcctcgtcttt
ggagagtccctgctcaatgacgccgtcactgtggtcctgtatcatctctttgaggagttt
gccagctatgaccgtgtgggcattgtggacattgtcctcggcttcttgagtttcttcgtg
gtgtccctgggtggggtctttgtgggcgtggtctacggagtcatcacagccttcacctcc
agattcacttcccacattcgtgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacctgtcagctgaactcttccacctgtccggcatcatggcactcattgcctcaggg
gtggtgatgcgcccctacgtggaggccaatatctcccacaagtcgcacacgaccatcaag
tatttcctgaagatgtggagcagtgtcagcgagaccctcatcttcatcttcctcggcgtc
tccaccgtggccggctcccaccactggaactggacctttgtcatcagcaccctgctcttc
tgcctcatcgctcgagtgctgggtgtgctgggcctgacctggttcatcaacaagttccgc
atcgtgaagctgacgcccaaggatcagttcattattgcctatgggggcctgcgaggggcc
atcgccttctctctgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcaccgtcatcttcttcaccgtttttgtgcagggtatgaccattcgg
cccctggtagacctgttggctgtgaagaaaaagcaggaaacgaagcgctccatcaacgag
gagatccacacgcagttcctggaccaccttctgacaggcatcgaggacatctgtggtcac
tacggccaccaccactggaaggacaagctcaaccgatttaacaagaagtatgtgaagaag
tgtctgatagccggggagcgctccaaggagccccagctcatcgctttctaccacaagatg
gagatgaagcaggctatcgagctggtggaaagtggtggcatgggcaagatcccctctgct
gtctccaccgtctccatgcagaatatccaccccaagtccctgcctgctgaccgcatcctg
ccagcactttccaaggacaaggaagaggagattcgcaaaatcctgaggaacaacttgcag
aagaccaggcagcggctgcggtcttacaacagacacacactggtggcagacccctacgag
gaggcctggaaccagatgctgctccggagacagaaggtccggcgattggaacagaagatc
aacaactacctgacagtgccggcccacaaactggactcccccaccatgtctcgggcccgc
atcggctcagacccgctggcctacgagccgaaggccgacttgcctgttatcaccatcgac
ccagcctccccacagtcacccgagtctgtggacctggtgaatgaggagctgaagggcaag
gtccttgggctgaaccggagccccagggtgactgaggaggaggaggatgatgacggaggc
attgtgattcggaccaaggagccctcctcccctggcactgatgatgtcttcacccctggg
ccgagtgacagccccagctcccagaggatacagcgctgcctcagcgacccaggcccccac
cctgagcctgaggagggagagcctttcatccccaaggggcagtag

DBGET integrated database retrieval system