KEGG   Miniopterus natalensis: 107540056Help
Entry
107540056         CDS       T05883                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mna  Miniopterus natalensis
Pathway
mna03030  DNA replication
mna03410  Base excision repair
mna03420  Nucleotide excision repair
mna03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107540056 (LIG1)
   03410 Base excision repair
    107540056 (LIG1)
   03420 Nucleotide excision repair
    107540056 (LIG1)
   03430 Mismatch repair
    107540056 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107540056 (LIG1)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107540056 (LIG1)
Enzymes [BR:mna01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107540056 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     107540056 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107540056 (LIG1)
DNA replication proteins [BR:mna03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107540056 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107540056 (LIG1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107540056 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     107540056 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     107540056 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 107540056
NCBI-ProteinID: XP_016072219
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MQRSIMSFFSPKKEGKAKKPEETSNSIREAEPPPKVALKERNGVVPERDSPVKRPGRRAA
RVLGSEGEEEDEAATPPKSQPAPDSLQGSPPGPVTFPETSPSLSNTSPVHISPSGIPKRR
TARKQVSKRTSQDVVAEHRAPKRKKEEEAETPTESLPELEGVKEEEAEEGDPPTTPPEPQ
NACRAEPLTESGPEPKQVKQEPQDEGQAEPSPRIPRTLSSFFTPRKPAIKKEVKEEGSGT
PSKEMPKGLLHSDMSSSPLDPSSYNPAKKNYHPLQDACWTQGQKVPYLAVARTFEKIEEV
SARLRMVETLSNLLRSVVALSPPDLLPILYLSLNCLGPPQQGLELGVGDGVLLKAVAQAT
GRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPALTASGVIAKFRDIARLTGSASIAR
KIDIIKGLFVACRHSEARFITRALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVD
AGKGKTAEARKAWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCKLSPGVPLKP
MLAHPTRGVSEVLKRFDEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDII
SRIPKMKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDL
IYLNGKSLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVDQIAEFLEQSVKDSCEGL
MVKTLDVDATYEFAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAS
YDAESEELQAICKLGTGFSDEELEEYHQTLQALVLPTPRSYVRADGAVAPDHWLEPSTVW
EVRCADLSLSPIYPAARGLVDSEKGISLRFPRFVRVREDKKPEEATTSAQVAWLYRRQSQ
IQNQEDTDLDSDLEDFY
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttctcccccaagaaagagggcaaagcaaagaagcca
gaggagacatccaacagcatcagagaggctgagccccctccgaaggtggcgctgaaggag
cggaatggagtggtgcctgagagggactctccggtgaagaggccggggaggagggcggct
cgggtcctgggcagcgaaggggaggaggaggatgaagccgccacgccccccaaaagccag
cctgcccccgactctctacagggctcccctcccggtcctgtcacatttcctgagaccagc
ccttccctctccaacacttctccagtgcacatttccccgtcagggatcccgaagcgtcgc
acagctcggaagcaggtttctaaacggacgtctcaggatgtcgtggccgagcaccgagca
cccaagaggaagaaggaggaagaagcagagaccccgacagaaagcctcccagaactggaa
ggggtcaaagaggaggaagcagaagagggggacccacccacgacgccccctgagccccaa
aatgcctgcagagcagagcccctgacagaaagtggtcccgagcctaagcaggtgaagcag
gagccccaggacgagggccaagctgagccttcccctagaattcccaggacgctgagcagt
ttcttcacccctcggaagcctgcaatcaaaaaagaagtgaaagaagaagggtctggcacc
ccaagcaaggagatgcccaaaggactcttgcactcggatatgagctccagccccctggac
ccatccagctacaatcctgccaagaaaaactaccatcccctccaggacgcatgctggaca
cagggccagaaggtcccttatctggctgtggcgcggacctttgagaagatcgaggaggtt
tctgctcggctcaggatggtggagacactgagcaacttgcttcgctccgtggtggccctg
tcacctccagacctcctccccatcctctatctcagccttaactgcctcgggcctccccag
cagggcctggagcttggcgttggggatggtgtccttctaaaggcggtggcccaggccaca
ggtcggcagctcgagtctgtccgggctgaggcagccgagaagggggatgtggggctggta
gctgagaacagccgcagcacccagagactcatgctgccccctcccgccctcactgcctcc
ggggtcatcgccaagttccgagacatcgcccggctcactggcagcgcttctatagccagg
aagattgacatcatcaaaggcctctttgttgcctgccgccactcggaagcccgattcatc
accagagccctgagtggacggctgcgccttgggctggcagagcagtcggtgctggctgcc
ctcgcccaggccgtgagcctcacgcccccaggccaagaattccccccagctgtggtggat
gctgggaagggcaagacagcggaggccagaaaggcgtggctggaggagcaaggcatgatc
ctgaagcagacgttctgcgaggtgcctgacctggaccggatcgtccctgtgttgctggag
catggcctggaacggctcccggagcactgcaagctgagcccaggggttcccctgaaacca
atgttagcccaccccacccggggtgtcagtgaggtcctgaaacgcttcgatgaggcagct
ttcacctgcgagtacaaatacgatgggcagagggcacagatccatgttctggaaggcggg
gaggtgaagatcttcagcaggaatcaggaagacaatactgggaagtaccctgacatcatc
agccgcatccccaagatgaaactcccgtcagtcacatccttcattttggacgcagaggct
gtggcttgggaccgagaaaagaagcagatccagccattccaagtgctcaccacccgcaaa
cgcaaggaggtggacgcagcagagatccaggtgcaggtctgcttgtacgctttcgatctc
atctacctcaacggaaagtccctggtgcgtgagcccctttcccgacgccggcagctgctc
cgagagaacttcgtggagacggagggtgagtttgtctttgccacctccctggacaccaag
gatgtggaccagattgcagagttcttggagcagtcagtgaaagactcctgtgaggggctg
atggtgaaaaccctggatgtcgatgccacctacgagttcgccaagagatcacacaactgg
ctcaagctgaagaaggactacttggacggcgtgggcgacaccctggatcttgtggtgatt
ggcgcctacctgggccgggggaagcgggccggccgctatgggggcttcctgctggcctcc
tacgatgcggagagtgaggagctccaggccatatgcaagctcggaactggcttcagcgat
gaagagctggaggaatatcaccagaccctccaggccctagtactgcccaccccacgctcc
tacgtccgggcagacggtgccgtggcccctgaccactggctggagcccagcactgtgtgg
gaggtcagatgcgccgacctctccctgtctcccatttacccggctgcccgtggtctggtg
gacagtgagaaggggatctcccttcgcttccctcggtttgttcgcgtccgtgaagataag
aagccagaggaggccaccaccagtgcccaggtggcctggctgtacaggaggcagagtcag
attcagaaccaggaggacacagacctggactccgacctggaggatttctactag

DBGET integrated database retrieval system