KEGG   Miniopterus natalensis: 107540409
Entry
107540409         CDS       T05883                                 

Gene name
PLIN1
Definition
(RefSeq) perilipin-1
  KO
K08768  perilipin-1
Organism
mna  Miniopterus natalensis
Pathway
mna03320  PPAR signaling pathway
mna04371  Apelin signaling pathway
mna04714  Thermogenesis
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107540409 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107540409 (PLIN1)
   03320 PPAR signaling pathway
    107540409 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107540409 (PLIN1)
SSDB
Motif
Pfam: Perilipin DUF719
Other DBs
NCBI-GeneID: 107540409
NCBI-ProteinID: XP_016072656
LinkDB
Position
Unknown
AA seq 507 aa
MAVNKGPALPDGDCPEQENVLQRVLQLPVVSGTCECVQKTYTSTKEAHPLVASVCNAYEK
GVQGASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKGTI
STRLRSARNSISVPIASTSDKVLGAALASCELAWGVAKDTAEYAANTRAGRLASGGADLA
LGGVEKVVEYLLPPDKEESAPAPGCQQAQKSPKTKPSLVSRVGSLANTLSRHTLQTTAQV
LKQGHALAMWIPGVAPLNSLAQWSASVAMQVVSRRRESEVRVPWLHNLATAYEEAQDDQT
DSEAEETKEDEQEEEAEEQFSEVAAPPRPQGILGSTVHTLQKAVRGTISAVLWAPKAVLG
TAGRVLHLTPAPAISSTKGRAMSLSEALKGVTDNVVDTVVNYVPLPRLSLMEPESEFQNI
ETERRASAAPPAGPEATSRWAQHRGSLRSMRGPGLEDRGDLPAALRSSFPGGPREKPARR
VSDSFFRPSVMEPILGRAQYSQLRKKS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcagttaacaagggccccgccttgccggatggagactgccctgagcaggagaacgtg
ctgcagcgggtcctgcagctgcccgtggtgagtggcacctgcgagtgcgtccagaagacc
tacaccagcaccaaggaggcccacccgttggtggcctctgtgtgcaatgcctacgagaag
ggcgtgcagggcgccagcagcctggccgcctggagcatggagccggtggtccgcaggctg
tccacgcagttcacagctgccaatgagctggcctgccggggcctggaccacctggaggag
aagatcccagcgctgcagtaccctcctgaaaagattgcctcggagctgaagggcaccatc
tccacccgcctgcgcagcgcccggaacagcatcagtgtgcccatcgccagtacttccgac
aaggtcctgggggctgctctggccagctgtgagctcgcctggggggtggccaaagacact
gctgagtatgctgccaacacccgagccggccggctggcctctggaggggccgacctggcc
ctgggtggtgtggagaaggtggttgagtacctcctccctccagacaaggaagagtcagcc
cctgctccaggatgccagcaggcccagaaatcccccaagaccaagccaagccttgtgagc
agggttgggagcctggccaacaccctctctcgacacacgctccagaccacagcgcaggtg
ctgaagcagggccacgccctggccatgtggatcccgggtgtggcacccctgaacagcctg
gcccagtggagtgcgtcagtggccatgcaggtggtgtcccggcggcgggagagcgaggtg
cgggtgccctggctgcacaacctggccaccgcctacgaggaagcccaggatgaccagaca
gacagcgaggcagaggagaccaaggaagacgaacaggaggaggaggctgaggagcagttc
agcgaggtagcagccccgccccgcccgcagggcatcctgggcagcacggtgcacaccctg
cagaaggctgtccggggcaccatctcggctgtgctgtgggcacctaaagctgtgctgggc
actgcagggagggtgctgcacctcacaccggcccccgccatctcctcgaccaaggggagg
gccatgtccctgtcagaagccctgaagggggtcacagacaacgtggtggacacagtggtg
aactatgtgccgctccccaggttgtcactgatggagcccgagagcgagttccagaacatc
gagaccgagcgcagggcgtctgcagcgccgccagccggcccggaggccacatcgcgctgg
gcgcagcaccgaggcagcctgcgcagcatgagggggccaggcctggaggaccgaggggac
ctgcccgccgcgctgcgctcgtctttcccgggcgggccccgcgagaagccggcgcgcagg
gtcagcgacagcttcttccggcccagcgtcatggagcccatcctgggccgcgcgcagtac
agccagctgcgcaagaagagctga

DBGET integrated database retrieval system