KEGG   Miniopterus natalensis: 107540586
Entry
107540586         CDS       T05883                                 

Gene name
ADRB2
Definition
(RefSeq) beta-2 adrenergic receptor
  KO
K04142  adrenergic receptor beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04261  Adrenergic signaling in cardiomyocytes
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107540586 (ADRB2)
   04024 cAMP signaling pathway
    107540586 (ADRB2)
   04022 cGMP-PKG signaling pathway
    107540586 (ADRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107540586 (ADRB2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107540586 (ADRB2)
   04924 Renin secretion
    107540586 (ADRB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107540586 (ADRB2)
  09154 Digestive system
   04970 Salivary secretion
    107540586 (ADRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107540586 (ADRB2)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107540586 (ADRB2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 107540586
NCBI-ProteinID: XP_016072855
LinkDB
Position
Unknown
AA seq 417 aa
MGQPGNRSVFLLAPNGSHAPDQGVAQERDQAWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILLVWIVSGLTSFLPIQMHWYRATHQE
AIKCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQRIDKFEGRF
HAQNLSQMEQDGRSGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNVVHVVQD
NLIPKEIYTLLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNSNDK
SDYTGEQSGCHLAQEKDSKLLSEDAPGREDLVSRQGTVPKDSVDSRGRNCSTHDSLL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggggcagcccgggaaccgcagcgtcttcttgctggctcccaacggcagccacgcgccg
gaccaaggcgtggcgcaggaacgggaccaggcgtgggtggtgggcatgggcatcgtcatg
tcgctgatcgtgctggccatcgtgttcgggaacgtgctggtcatcacagccattgccaag
ttcgagcgtctgcagacggtcaccaactacttcatcacctccctggcctgcgcggacctg
gtcatgggcctggcggtggtgcccttcggggccagccacatcctcatgaaaatgtggact
tttggcaacttctggtgcgagttctggacttccatcgacgtgctgtgcgtcacggccagc
atcgagaccctgtgcgtgatcgcggtggaccgctacttcgccatcacgtcgcccttcaag
taccagagcctgctgaccaagaacaaggcccgggtggtcattctgctggtgtggatcgtg
tcaggcctcacctccttcctgcccatccagatgcactggtaccgggccacccaccaagag
gccatcaagtgctacgccaaagagacctgctgcgacttcttcacgaaccaagcttacgcc
atcgcctcctccatcgtttccttctacctgcccctggtggtcatggtcttcgtctactcc
agggtcttccaggtggccaaacggcaactccaaaggatcgacaaattcgagggccgcttc
cacgcccagaacctcagccagatggagcaggacgggaggagcggacatgggcaccgcagg
tcctccaagttctgcttgaaggagcacaaagccctcaagactctaggcatcatcatgggc
acgttcaccctgtgctggctgcctttcttcattgtcaacgtcgtgcacgtggtccaggat
aacctcatccccaaggaaatttacacccttctgaactgggtgggctacgtcaactctgct
ttcaaccccctcatctactgccggagcccggatttcaggatcgccttccaggagctcctg
tgcctgcgcaggtcttctctgaaggcctatgggaatggctactccaacagcaacgacaag
tctgactacacgggggagcagagtggatgtcacctggcgcaggagaaagacagcaagctg
ctgagcgaggatgcccccggcagggaagacttggtgagccggcaaggtactgtgcctaaa
gatagcgttgattcacgagggaggaattgtagcacacacgactcgctgctctaa

DBGET integrated database retrieval system