KEGG   Miniopterus natalensis: 107540632
Entry
107540632         CDS       T05883                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04520  Adherens junction
mna04910  Insulin signaling pathway
mna04913  Ovarian steroidogenesis
mna04923  Regulation of lipolysis in adipocytes
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04960  Aldosterone-regulated sodium reabsorption
mna05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107540632 (INSR)
   04014 Ras signaling pathway
    107540632 (INSR)
   04015 Rap1 signaling pathway
    107540632 (INSR)
   04066 HIF-1 signaling pathway
    107540632 (INSR)
   04068 FoxO signaling pathway
    107540632 (INSR)
   04072 Phospholipase D signaling pathway
    107540632 (INSR)
   04022 cGMP-PKG signaling pathway
    107540632 (INSR)
   04151 PI3K-Akt signaling pathway
    107540632 (INSR)
   04152 AMPK signaling pathway
    107540632 (INSR)
   04150 mTOR signaling pathway
    107540632 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107540632 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107540632 (INSR)
   04923 Regulation of lipolysis in adipocytes
    107540632 (INSR)
   04913 Ovarian steroidogenesis
    107540632 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107540632 (INSR)
  09149 Aging
   04211 Longevity regulating pathway
    107540632 (INSR)
   04213 Longevity regulating pathway - multiple species
    107540632 (INSR)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107540632 (INSR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107540632 (INSR)
   04932 Non-alcoholic fatty liver disease
    107540632 (INSR)
   04931 Insulin resistance
    107540632 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107540632 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107540632 (INSR)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107540632 (INSR)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   107540632 (INSR)
CD molecules [BR:mna04090]
 Proteins
  107540632 (INSR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like B2
Other DBs
NCBI-GeneID: 107540632
NCBI-ProteinID: XP_016072913
LinkDB
Position
Unknown
AA seq 1393 aa
MGTLGICEGENRLAEKPLPLPGESVGPRSSVHEAGPATNSSNPPIACELTCHAFCIFSLV
VCPSMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPNLIMITDYLLLFRV
YGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNELC
YLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHS
HCQKVCPTSCKSHGCTAEGLCCHSECLGNCSEPNDPTKCAACRHFYLDGRCVETCPPPYY
HFQDWRCVNFSFCQDLHNRCKNSRRPGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLG
PCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISG
YLKIRRSYALVSLSFFRKLRLIQGDTLEIGNYSFYALDNQNLRQLWDWNKHNLTITQGKL
FFHYNPKLCLSEIHKMEEISGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKIL
LRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQ
NHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSN
SSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPSELEG
SQKHNQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRALG
EEGNVTTVVPTAPGFPNTSSTIVPTSWEEQRPFEKVVNKESLVISGLRHFTGYRIELQAC
NQDSPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYE
VSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRIRATSLAGNGSWTDPTYFYVA
NYLDVPSNIAKIVIGPLVFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDV
FPCSVYVPDEWEVPRDKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASL
RERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMTHGDLKSHLRSLRPDAENN
PGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIY
ETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQV
LKFVMDGGYLEQPENSPERLNELMRMCWHFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFY
SDENKAPESEELEMEFEDMESVPLDRSSHSQREDDGGSSLGRKRSYEDHISYTHMNGGKK
NGRVLTLPRSSPS
NT seq 4182 nt   +upstreamnt  +downstreamnt
atgggcacactgggtatttgtgaaggagagaacagacttgctgagaagcccttgccactc
ccaggtgaaagtgtgggacccagatccagtgtccatgaagctggccctgccactaattct
tccaacccacccattgcctgtgagctcacctgtcatgctttctgcatattttcacttgta
gtgtgtcccagcatggatatccggaacaacctcacgaggctgcacgagctggccaactgc
tcggtcatcgaaggacatttgcagatactgttgatgttcaaaacgaggcccgaggatttc
cgagacctcagtttccccaacctcatcatgatcactgattacttgctgctgtttcgggtc
tatgggctggagagcctgaaggacctattccccaacctcacggtcatccggggctcccgg
ctcttcttcaactatgcgctggtcatcttcgagatggttcacctgaaggagctcggcctc
tacagcctgatgaacatcacccgggggtccgtccgcattgagaagaacaatgagctctgc
tacctggcgaccatcgactggtcgcgcatcctggactcggtggaggataattacatcgtg
ctcaacaaagatgacaatgaagagtgtggggacatctgtccaggcactgcaaagggcaag
accaactgccctgccactgtcatcaatggacagttcgtcgagcggtgttggactcacagc
cattgccagaaagtctgcccgaccagctgtaagtcgcacggctgcactgctgaaggcctc
tgctgccacagcgagtgcctgggcaactgctcggagcccaacgaccccaccaagtgcgcg
gcctgccgccacttctacctggacggtcggtgcgtggagacctgcccgcccccgtactat
cacttccaggactggcgctgtgtgaacttcagcttctgccaggacctgcacaacagatgc
aagaactcgcggaggccgggctgccaccagtatgtcattcacaacaacaagtgcattcct
gagtgtccctctggatacacgatgaattccagcaacttgatgtgcactccgtgtctgggc
ccctgtcccaaggtctgtcacctcctggaaggcgagaagaccatcgactccgtgacatct
gcccaggagctccgaggctgcaccgtcatcaacgggagcctgatcatcaacatccgaggg
ggcaacaacctggcagctgagctagaggccaaccttggcctcattgaggaaatttcaggg
tatctgaaaatccgccgttcctatgctctcgtgtcactttccttcttccggaagttacgt
ctgattcagggggacaccttggaaatcgggaactactctttctatgcattggacaaccaa
aacctaaggcagctatgggactggaacaaacacaacctcaccatcactcaggggaaactc
ttcttccactataatcccaaactctgcttgtcggaaattcacaagatggaagaaatttca
ggaaccaaggggcgccaggagaggaacgacattgccctgaagaccaatggggaccaggcg
tcctgtgaaaatgaattacttaaattttcttacattcggacatcttttgacaagatcttg
ctgagatgggagccatactggccccctgacttccgagaccttctggggttcatgctcttc
tacaaagaggcgccttaccagaacgtgacggagtttgacggccaggatgcgtgtggatcc
aatagctggacagtggtggacattgacccccctctaaggtccaatgaccctaagtcgcag
aaccaccctgggtggctgatgcggggcctcaagccctggactcagtacgccatcttcgtg
aagaccttggtcaccttttctgatgaacgtcgcacatatggggccaagagcgatatcatc
tatgtccagacagatgccaccaatccttccgtccccctggatcccatctcggtttcgaac
tcttcatcccagattatcctgaagtggaagcctccctctgaccccaacggcaacatcact
cactacctggtcttctgggagaggcaggcagaagacagtgagctgttcgagttggattat
tgcctcaaagggttgaagctgccctcccggacttggtctccaccgtctgagttggagggg
tcccagaagcacaaccagagtgagtacgaggagtctgccggcgaatgctgctcctgcccc
aagactgactcccagattctgaaggaactagaggagtcctcgttcaggaagacgtttgag
gattacctgcacaatgtggttttcgtgcccaggccatcaaggaaacgcagggccctcggc
gaggaggggaatgtgacgacggtcgtgcccacagctccgggtttccccaatacctcctca
acgatcgtgcccacaagctgggaggagcagcggcccttcgagaaagtggtgaacaaggag
tcgctggtcatctccggcctgcgccacttcactggctaccgcatcgagctgcaggcttgc
aaccaggattcgcccgaggaaaggtgcagcgtggcggcctatgtcagcgccaggaccatg
cccgaagccaaggcagatgacattgttggtcccgtgacccatgaaatcttcgagaacaac
atcgttcatttgatgtggcaggagccaaaggagcccaacggtctgattgtgctgtatgaa
gtgagttaccgacgatatggagatgaggagctgcacctctgtgtgtcccgcaggcatttt
gctctggagcggggctgcaggctgcgtgggctgcctccgggcaattacagcgtgaggata
cgggccacctccctggcgggcaatggttcctggacggaccccacctatttttatgtggca
aactacttagatgttccatcaaatattgcaaaaatcgtcatcggcccccttgtctttgtc
tttctcttcagtgttgtgattggaagtatttacctgttcctgaggaagaggcagccagat
gggccgatgggaccactctatgcttcttcaaaccctgagtacctcagtgccagcgatgtg
ttcccctgttctgtatacgtgccggatgagtgggaagtgcctcgggataagatcaccctc
ctgcgagagctggggcagggctccttcggcatggtgtatgagggcaacgccaaggacatc
atcaagggcgaggcagagactcgagtggcggtgaagacagtcaacgagtcggccagtctg
cgggagcggatcgagtttctcaacgaggcctcagtcatgaaaggcttcacctgccatcac
gtggtccggctcctcggggtggtgtccaaaggccagcctacgctggtggtgatggagctg
atgactcacggagacctgaagagccaccttcggtccctgcggcctgacgccgagaataac
cccggccgcccgccccccaccctgcaagagatgattcagatggcggcggagatcgctgat
ggcatggcctatctgaacgccaagaagttcgtgcaccgggacctcgcggctcgaaactgc
atggtggcccacgattttaccgtcaaaatcggagactttggaatgaccagagacatctat
gaaacggactattaccggaaaggcggcaagggcctgcttcctgtgcgctggatggcacct
gagtctttgaaggacggggtctttaccacttcctctgacatgtggtccttcggcgtggtc
ctttgggaaatcaccagcttggcagaacagccttaccaaggcctctctaatgagcaggtg
ttgaaatttgtcatggatggagggtatctggagcaacctgaaaatagtccagagagactc
aacgaattgatgcgcatgtgctggcacttcaaccccaaaatgaggccgaccttcctagag
atcgtcgacctgcttaaggacgacctgcaccccagctttccggaagtttctttcttctac
agtgatgagaacaaggctcctgagagcgaggagttggagatggagtttgaggacatggag
agtgtacccctggaccggtcctcacactctcagagggaggacgatggggggtcctcgcta
ggccgaaagcggagttacgaggatcacatctcctacacccacatgaacgggggcaagaaa
aatggacgggtcctgactctgccacggtccagtccttcctaa

DBGET integrated database retrieval system