KEGG   Miniopterus natalensis: 107540656
Entry
107540656         CDS       T05883                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00250  Alanine, aspartate and glutamate metabolism
mna00471  D-Glutamine and D-glutamate metabolism
mna01100  Metabolic pathways
mna04724  Glutamatergic synapse
mna04727  GABAergic synapse
mna04964  Proximal tubule bicarbonate reclamation
mna05206  MicroRNAs in cancer
mna05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107540656 (GLS)
   00220 Arginine biosynthesis
    107540656 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    107540656 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107540656 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540656 (GLS)
   04727 GABAergic synapse
    107540656 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107540656 (GLS)
   05230 Central carbon metabolism in cancer
    107540656 (GLS)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     107540656 (GLS)
SSDB
Motif
Pfam: Glutaminase Ank_2 Ank_4 EF-hand_14 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 107540656
NCBI-ProteinID: XP_016072981
LinkDB
Position
Unknown
AA seq 491 aa
MDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELFESA
KKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVN
DLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYV
MQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLC
SIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAK
KLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGH
VEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQGQYTPQGDSDDGKEN
QTVHKNLDGLL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggatatgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagat
ctttttaaaaagtgtgttcaaagcaacattgttttgttgacacaagcctttagaagaaaa
tttgtcattcctgactttatgtcttttacctctcatattgatgagttatttgaaagtgct
aagaagcagtctggaggaaaggttgcagattatattcctcaactagccaagttcagtcct
gatttgtggggtgtatctgtttgtacagtagatggacaaaggcattctattggagatacc
aaagttccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaat
gatcttggaacagaatatgtgcatcggtatgttgggaaagagccaagtggattaaggttc
aacaaactgttcttaaatgaagatgacaagccacataatcctatggtaaacgctggagca
attgttgtgacttcattaataaagcaaggagtgaataatgccgaaaaatttgactatgtg
atgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgttt
cagtctgaaagagagagtggagatcgaaattttgcaataggatattacttaaaagaaaaa
aagtgttttccagaaggcacagacatggttggtatattagacttctatttccagctatgc
tccattgaagtaacttgtgaatctgctagtgtgatggctgcaacactggctaatggcggt
ttctgcccaattactggtgaaagagtactgagccctgaagcagttcgaaatacactaagt
ttgatgcattcctgtggcatgtatgatttctcagggcagttcgctttccacgttggtctt
cctgcaaaatctggagttgctgggggcattcttttagttgtccccaatgtcatgggcatg
atgtgctggtctccccctttggacaaaatgggcaacagtgttaagggaattcacttctgt
catgatcttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaa
aaacttgatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaacctcttg
tttgctgcgtatactggagatgtgtctgcacttcgaagatttgcactgtcagccatggac
atggaacagcgagactatgactctagaacagctctccatgtagctgctgcggagggtcat
gttgaagttgttaaatttttgctggaagcctgcaaagtaaatcctttccccaaggacagg
tggaacaacactcccatggatgaggcgctgcacttcggacaccacgacgtatttaaaatc
ctccaggaataccagggccagtacacacctcaaggagactccgacgacggaaaggaaaat
caaaccgtccataagaatcttgatggactcctgtaa

KEGG   Miniopterus natalensis: 107546205
Entry
107546205         CDS       T05883                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00250  Alanine, aspartate and glutamate metabolism
mna00471  D-Glutamine and D-glutamate metabolism
mna01100  Metabolic pathways
mna04724  Glutamatergic synapse
mna04727  GABAergic synapse
mna04964  Proximal tubule bicarbonate reclamation
mna05206  MicroRNAs in cancer
mna05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107546205 (GLS2)
   00220 Arginine biosynthesis
    107546205 (GLS2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    107546205 (GLS2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107546205 (GLS2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546205 (GLS2)
   04727 GABAergic synapse
    107546205 (GLS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107546205 (GLS2)
   05230 Central carbon metabolism in cancer
    107546205 (GLS2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     107546205 (GLS2)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 107546205
NCBI-ProteinID: XP_016080015
LinkDB
Position
Unknown
AA seq 602 aa
MRSMKALQNALSRAGSQCWRGDWGHLSRSPLLGWGVRHHLSEAAAQGRKKPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRRMVR
ESSSGGLLDRELFQKCVSSNIVLLTQAFRKKFVIPDFEEFTRHVDRIFEDAGEFTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSAGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGDSVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCISPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTPYETQAEVAAEALSKENLES
MV
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaatgcgctgagcagggccggcagtcagtgctggcgg
ggagactggggtcacctgagccggagccccctccttggctggggcgtccggcaccacctc
agtgaggccgcggcgcagggcaggaagaagccgcacagccaccagccgcagcaccaggat
catgattcgtcagagagtggtatgctgtcccgcttgggtgatctgctcttctacactatt
gctgagggacaggaacgaatccctatacacaagttcacaactgcactgaaggctactgga
ttacagacgtcagatccccggctccgagactgcatgagccagatgcgccgcatggttcga
gagtccagcagtggtggcctcttggaccgagagctcttccaaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccggaagaagtttgtcattcctgattttgaggagttc
acaagacatgtggatcgcatctttgaggatgccggagagttcactggaggcaaagtggca
gcctacatccctcagctggccaagtcaaacccagacctgtggggcgtctccctgtgcact
gtggatggtcagcggcactccgccggccacacaaagatccccttctgcctgcagtcctgt
gtaaagcccctcacctatgccatctctgtaagcaccctagggactgactacgtgcacaag
tttgtgggcaaggagcccagtggcctgcgttacaacaagctctccctcaatgaggaagga
atcccccataaccctatggtcaatgctggtgccattgtcgtgagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcaatatctgaacaaaatggctgga
aatgaatacgtgggtttcagcaatgccacattccagtcagagaaggaaacgggggatcgg
aattatgccatcggctattatctaaaggaaaagaagtgctttcctaagggggtggacatg
atggctgccctcgatctctacttccagctgtgctccgtggaggtaacctgtgaatcaggc
agtgtcatggcagccaccctggccaatggcgggatctgccccatcacaggcgacagcgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcactcctgcggcatgtatgac
ttctcgggccagtttgccttccatgtgggcctgccagccaagtcagctgtgtcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcatctcacctccactggacaag
ctggggaacagccacaggggcatcagtttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggga
gaagttaggaacaagactgtggtaaacctcttatttgctgcctatagtggagatgtctca
gctcttcgaaggtttgccttgtcagctatggacatggaacagaaagactatgactcccgc
acagccctgcatgttgctgcagctgaaggacacattgaagttgttaaattcctgattgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaatcacctggaggtggtgaaactacttcaagattaccaggactcctacaca
ccatatgagactcaggctgaagtagcagctgaggctctgtctaaagagaacttagagagc
atggtgtga

DBGET integrated database retrieval system