KEGG   Miniopterus natalensis: 107540682
Entry
107540682         CDS       T05883                                 

Gene name
REV3L
Definition
(RefSeq) DNA polymerase zeta catalytic subunit isoform X1
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107540682 (REV3L)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107540682 (REV3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107540682 (REV3L)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107540682 (REV3L)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    107540682 (REV3L)
SSDB
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Other DBs
NCBI-GeneID: 107540682
NCBI-ProteinID: XP_016072971
LinkDB
Position
Unknown
AA seq 3093 aa
MIRLCNTGQKTCLHLHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGTPSSTAQ
HVFKVSLVSGMPFYGYHEKERHFMKIYLYNPAMVKRICELLQSGAIMNRFYQPHEAHIPY
LLQLFIDYNLYGMNLINLAAVKFRKARRKSDPLHATGSYKDQLPGNSLTGTLFRWEENEI
PSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETS
QISQPESQDRRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHS
EVLSPEILQCTPANMVEVHKDTELSKGHTRHKIEEALINEQAILNLMENSQTFQPLTQRL
SESPVFMDSSPDEALVHLLAGLENDGYQGERNTKPSPCLSFGNTKNPQNSDDEENEPQIE
KEEMELSLVMSQRWDSNIEEHCAKKRSLCQGTQRSSTDEEGSSSEEEMEWSSNSLLLAGL
SIPQLDGTADENSDNPLDNENSRTHSSVIAASKLSVKPSIFHKDAATLEPPSSAKITFQC
KHTSALSSHVLNKEDLIEDLSQPNNTEKGLDHSVASFTNESTYSVKYPGSLSSTVHSENS
HKESSKKDILPVSSCESSIFDYEEDMPSVTRQVPSRKYTNVRKIDKDAPFIHINRHTGES
TLGKNSLNFSDLSHSKNKLSSEGNEKGNSTALNNLFPSSLTENCELLSCSGENRTMVHSL
DSIADESGLNKLKIRYEEFQEHKTEKPNLSQQAAHYMFFPSVVLSNCLSRPQKLSPVTYK
LQPSNKQSRLKMNRKKPVGHQETSTKTSETGPTKDNYVQNNPCSSNSEKNNVLASDLTKV
TRGAFENKTPPDGFIDCHFGDGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHN
SKISLPHPMEVGESLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSK
EKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKTKHKSAKKKTG
KQQRTNSENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYTDVMSKLGFLSERSTSP
INSSPPRCWSPTDPRAEEIMAAADKETMLFKGPNAYNSKTLNSRREKSSRARTQAKKSKT
KLVNPSVVTKKRNKRNQTDKVVDDGKKKPRAKQKQKTNEKGTSRKHITLKDEKLKYQSGA
EVKLVLKQNVSETSHSSGDSQLLFKQKDVSVMGSAVDHPLSAPQTTGIHAQQNLSGCFSS
FLESKKPVDLQTFPSSRDDLHPSVVSNSLGPGISKINVQRSHNQSAMFTLKESTLIQKNI
FDLSNHLSQVAQNTQISSGIISPKTEENANAQKNYLSSFGKLNEYRNSLESKPDQAYAPN
FLHCKDSQQQLVCMAEQSKHSETCSPGNAASEESQMPNNCFVTSLRSPIKQIAWEQKQRG
FILGMSNFKPERVKQRSLSEAISQTKALSQCKSQNVSTPSAFSEGQSGLAVLKELLQKRQ
QKAQNANIMQDPLPNKHQPNKNISVPLEHNKTTKRTRSVTSPRKPRTPRSTKPKEKIPKL
LKADSQNLQNSGRLDNSVSDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFC
SFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKTEFLSHDNQKCDEGKHHASDSSSWI
RSSTLSPELFEKSSIESNENHRHNQWKNSFRPLTTRSNSIIDSFCIQQAEDSLNEKSRLN
RSSVSKEVFFSLSQPGSSDWIQGHTRKEMGQSLDSVNTSFTTVLSSPDGELVDAASEDLE
LYVSRNNDILTPTPDSSPRSASSPSQSKNGSFTSRTAHILKPLMSPPSREEIMATLLDHD
LSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLPNDLAEFEGDFSLEGLRLWKTAFSA
MTQNPRPGSPLRNGQAFVNKGSSNSHKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYER
SKKLSKTEPAGVVKSAENFSSSVNPDDKPAVPPKMDTTPHTHPTTAHTKEDVDNSEIALQ
VPTTEYSRTASGSQTLPPVVSANNPKKDEDDDDDDYYASYSSPDSPVIPPWQQAVSPDSK
PLNGDDRPLAAVEELCSLTVENFLKPVKDGIQKSPCSEPQEPLVISPINVRAKTGIHESL
CLHSTPIIQRKLLERLPEATGLSPLSTESKSQKLSHKKESNTDTRRRIFLTQAKNQFAAV
NTPKKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLEPDPE
FDPICALFYCISSDTPLPNTDKTELTGVIVIDKDKTVSSQDIRFQTPLLIRSGITRLEVT
YAADEKALFQEIADIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVNLCQMISRVPDDKI
ENRFAAERDDYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFT
FRVLSDWFDNKTDLYRWKMVDHYISRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTR
GSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQS
LYPSIVIAYNYCFSTCLGHVETLGKYDEFKFGCTSLRVPPDLLYQIRHDITVSPNGIAFV
KPSVRKGVLPRMLEEILKTRLMVKQSMKAYKQDRALSRMLDARQLGLKLIANVTFGYTAA
NFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQS
FKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIET
VRRDSCPAVAKILERSLKLLFETRDISLIKQYVQRQCMKLLEGKASIQDFVFAKEYRGSF
SYKPGACVPALELTRKMLTYDRRSEPRVGERVPYVIIYGAPGVPLIQLVRRPVEVLQDPT
LRLNATYYITKQILPPLARVFSLIGIDVFSWYHELPRIQKATSSSRSEPEGRKGTISQYF
TTLHCPVCDDLTQHGICSRCRSQPQHVAVILNQEIRELERKQEQLVKICKNCTGCFDRHI
PCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
NT seq 9282 nt   +upstreamnt  +downstreamnt
atgattagactgtgcaacacaggtcagaagacatgtcttcatctacatggcattttccct
tacctctatgtgccatacgatggttatggacagcagccagaaagctatctttctcagatg
gcattcagtatcgacagagcacttaatgtggctttaggcactccatcttccactgctcag
cacgtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgagaaggaa
agacacttcatgaagatctatctttacaatcctgcgatggtgaaaaggatatgtgaactt
ttgcaaagtggagccataatgaatagattttatcagcctcatgaagcgcatattccctac
ctcctacagctcttcatcgactacaatctgtatggaatgaatttaataaatctggctgct
gtcaagttccgaaaagcaagaaggaaaagtgatccattgcatgcaactggatcttacaaa
gatcagctaccaggaaattctcttactggtacattatttcggtgggaagaaaatgaaatt
ccaagctctttaatactggaaggtgttgaaccacagagtacatgtgaattagaagtagat
gctgtagctgctgatatcttaaatcggctggacattgaagctcaaattggtggaaatcct
ggtctacaggccatatgggaagatgaaaagcaacggcgaagaaacagaaatgaaacttct
cagattagccaacctgaatcacaagatcgcaggtttgtgccagcaacagaaagtgaaaaa
aaatttcagaagagacttcaggaaattctcaaacagaatgacttctctgtaacgttatca
ggatctgtggactacagcgacggatcccaggagttctctgctgagttaacattgcactct
gaggtcctgtctcctgaaattcttcagtgtacaccagctaatatggtagaagtccacaaa
gacacagagttgagcaaaggtcacactaggcacaaaatagaggaagctcttattaatgaa
caagcaattttgaacctcatggaaaatagccagacttttcagcctttgacccaaagactg
agtgagtcaccagttttcatggacagtagtcctgatgaggctctggtacatcttcttgct
ggtttggaaaatgatgggtatcagggggaaagaaatacaaaaccatcaccatgtctttcc
tttggaaacactaaaaacccccaaaatagtgatgatgaagaaaatgaaccacagattgaa
aaagaagaaatggagcttagtttggttatgtctcagagatgggacagcaatattgaagaa
cattgtgccaaaaagagatcactgtgccaaggtacccagagaagctcaactgatgaagag
ggctcctcttcagaagaagaaatggaatggagtagtaacagcctgcttctagccggtctt
tctatacctcagttagatggaaccgcggacgaaaatagtgacaatccattggacaatgaa
aattctagaacccactcttctgtgattgcagcaagcaagctatcagtaaaaccttccatc
tttcacaaagatgctgctacattagaacccccatcttctgctaagattacctttcagtgt
aaacacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagacctt
tcgcagccaaacaatacagaaaaaggtctagatcattcagttgcttcttttaccaatgaa
agcacttactctgtgaaataccctggatctttaagcagtactgtccattcagaaaactct
cataaagaaagtagtaagaaagatatcctcccagtatcttcctgtgaaagtagtattttt
gattatgaagaagatatgccatctgttacaagacaagtaccaagtagaaagtatacaaac
gttagaaaaatcgataaggatgccccttttatacacataaaccgtcacactggcgaaagt
acattgggcaaaaattctttaaacttttctgacttaagtcattcaaaaaataaattatct
tctgaaggaaatgaaaagggaaacagcacagctctgaacaatttattcccttcatcatta
actgaaaattgtgaattgctatcatgctcaggggagaatagaactatggtacattctctt
gatagcattgctgatgaaagcggactaaataaacttaaaattagatatgaagaatttcaa
gaacataaaacagaaaaaccaaatctcagccagcaagcagcacattatatgttttttccc
agtgttgttctttctaattgtctcagtaggccacagaaactctctcctgtcacgtataaa
ctacaacccagtaataaacagtcccggttgaaaatgaatagaaagaaacctgtaggccat
caagagacttctaccaaaactagtgagactggccccacaaaagataattatgtacaaaat
aatccttgtagtagtaattctgagaagaataatgtgttggccagtgatttaactaaagtc
acccgcggagcttttgaaaataaaacacctccagacggttttatagactgtcactttgga
gatggaaccttagaaactgagcagtcctttggattgtatggaaataagtacacccttaga
gccaaacgcaaggtaaattatgagactgaagatagtgagtcaagttttgtaacacacaac
tcaaaaattagtctacctcatcccatggaagttggtgaaagtttagatggaactctcaaa
tcccgaaaaagaagaaaaatgtctaaaaagctgccccctgtcattataaagtatattatt
attaatagatttagagggaggaaaaatatgcttgtgaagctaggaaaaatagactctaaa
gaaaaacaagtaatattaacagaggaaaaaatggaactatataaaaaacttgcacctttg
aaggatttttggccaaaagttcctgactcccctgcaaccaaataccccatttatccatta
acaccaaagaaaagtcacagaagaaaaacaaaacataaatctgctaagaaaaaaactggt
aagcaacaaagaacaaacagtgaaaatattaaaaggactttgtctttccggaaaaaacgt
tcacatgctattctttctcctccctcaccatcttataatgctgaaaccgaagactgtgac
ttgaattatactgatgttatgtctaaactaggttttctttctgagagaagcacaagtcct
ataaattcttctccacctcgctgctggtctcccacagatccaagagctgaagaaattatg
gctgctgcagataaagaaacaatgctttttaagggtcctaatgcatataatagcaagact
cttaattcccgtagagaaaaaagtagtcgggcaagaacgcaggcgaagaaatcaaaaaca
aagcttgttaatccctctgtagttactaagaaaagaaacaaacgaaatcagacagataaa
gtagtagatgatgggaaaaagaaaccaagagcaaaacagaaacaaaaaacaaatgagaaa
ggtacatcgagaaagcacataacacttaaagatgaaaaattaaaatatcagtctggtgcc
gaagttaagcttgtgctgaaacagaatgtgtctgagacctcacatagttctggagattct
caactactctttaaacagaaagatgtttcagtaatgggttctgctgtagatcatcccctt
tctgctccccaaaccactggaattcatgcacaacagaatttatctggctgcttttcttct
ttcttagaaagcaagaagcctgtagatttgcaaacattccccagttctcgagatgatttg
catccttcagttgtttctaattctttgggacctggaatctcaaaaattaatgttcagagg
tctcataatcaaagtgctatgtttactctaaaggaatcaactttgattcagaaaaatata
tttgacctttccaaccatttgtctcaggttgcacagaatacacagatatcttcgggtata
atatctccaaagacagaagagaacgcaaatgcgcaaaagaactatttgtcgtccttcgga
aagttaaatgaatatcgtaattccctagagtcaaagccagaccaggcgtatgcccctaat
tttttgcattgcaaagacagtcagcagcagcttgtgtgcatggcagaacagtcaaagcac
agtgaaacttgttctccaggaaatgcagcgtcagaggaaagccaaatgcctaataattgc
tttgtaacttccctgagaagtccaatcaaacaaatagcatgggaacaaaaacagaggggc
tttattttaggtatgtcaaattttaaacctgaaagggtaaaacaaagatcattgtcagaa
gcaatttcacaaaccaaagcactttcccagtgtaaaagtcaaaatgtgtcaacaccttca
gcatttagtgaaggacagtctggactggcggttctaaaagaattgttacagaaaagacag
cagaaagcacaaaatgcaaatattatgcaagacccattacctaataaacatcaaccaaac
aaaaatatttctgttccccttgagcataacaaaacaactaaacgaacacgatcagtaaca
tctccaagaaaacctcgaactcccagaagtacaaaacctaaagaaaaaatccccaaactt
cttaaagcagactcccaaaatttacaaaactctggccggttggataactctgtgtcggat
gatagtcccatctttttttcagatccaggttttgagagttgttattcacttgaagacagc
ttgtctcctgaacataattataattttgatattaatacaattggtcaaactggattttgt
agcttttattctgggagtcagtttgtccccgctgatcagaatttgcctcagaagttccta
agtgatgcagttcaggatcttttcccaggacaagctatagaaaaaactgagtttttaagt
catgataaccagaagtgtgatgaaggcaaacatcatgcctcggactcatcttcatggatt
agatctagtactcttagtcctgaactgtttgagaaatcatccatagagagcaacgagaat
catcgccacaaccaatggaaaaatagcttccgtcctttaacaactcggtcgaattcaata
atagattctttctgtatccagcaggcagaggacagtctaaatgaaaaatccagattgaat
aggagttcagtaagcaaagaagtgttttttagcctctcacagcctggcagttcagactgg
attcaaggtcataccagaaaagaaatgggacagtctcttgactcagtcaatacctctttc
actacagtactatcctcccctgatggtgaacttgtggatgctgcctctgaggatttagaa
ttgtatgtttcaagaaataatgatatattgacaccaactcctgatagttcaccgaggtct
gccagctctccctcacaatctaaaaatggcagtttcacctctcgaactgctcacattctg
aaaccacttatgtccccaccaagtagggaagaaataatggcaaccttgttggatcacgac
ctttcagaaactatttaccaggaaccattttgcagtaatccttctgatgtaccagaaaag
cccagagagatcggcggacggcttctcatggtagaaactcgacttccaaatgatctagct
gagtttgagggagacttttcattggaaggacttcgtctgtggaaaacagcattctcggca
atgactcaaaacccaagaccagggtcacccctccgtaatggccaagcatttgtcaataaa
gggtcaagtaatagccataaaatggtggaagataaaaaaattgtgattatgccttgtaaa
tgtgccccaagtcgacaactggttcaagtatggcttcaagccaaagaagaatacgaacgt
tccaagaaactgtctaaaactgagccagctggagttgtaaaatctgctgagaacttcagc
tcttcagttaacccagatgacaaacctgcagtgcctccaaaaatggatacaactccacat
acacaccccactacagcacataccaaggaagatgttgataattctgagattgctttacaa
gttccaaccacagaatatagtcgaactgcaagtggaagtcagacgttgccaccagttgtt
tctgcaaataatcctaagaaagatgaagatgatgatgatgatgactattatgctagttat
agctcccctgattctccagtaattccgccttggcagcaagcagtatccccagattccaaa
ccattgaatggagatgacagacccttagcagcagtagaggaactatgttccctgactgtt
gagaacttcttaaagccagtaaaagatggtatacagaaaagcccctgcagtgagcctcag
gagcctctagtgatatctccaattaatgttagggcaaaaactgggatacatgagtcactt
tgccttcatagtacaccaatcatacagagaaaacttctggaaaggcttcctgaagcaact
ggccttagccctttatcaacagaatcaaaatcccagaaattgagtcataagaaagaaagt
aatactgacactcgtagaagaatattcttaacacaagcaaagaatcaatttgcagcagta
aataccccaaagaaagaaacttctcagattgatggaccatctttaaacaatacttacggt
ttcaaagtcagcatacaaaacttacaggaagcaaaagctttacatgagatacagaatctt
accctaatcagtgtggagttacatgctcgaactagacgagacttagaaccagatcctgaa
tttgacccaatctgtgctctgttctactgcatctcatctgatacgccactaccaaacaca
gacaaaacagaactcacaggtgtaatagtgattgataaagataagacagtctccagtcaa
gatatcagatttcagaccccgttacttattagatctggaattacaagactagaagttact
tatgctgctgatgagaaggcactttttcaagaaattgcagatataataaagaggtatgat
cctgatattctgctaggatatgagattcagatgcattcctggggctacctcttgcaaagg
gctgctgccttaagtgttaacttatgtcagatgatctctcgggtgccagatgacaaaatt
gagaacagatttgcagctgaaagagatgactatggatcagatacaatgagtgagataaat
attgttggccgaattacactaaatctttggagaataatgagaaatgaggtggcgctaact
aactacacctttgaaaatgtgagctttcacgttcttcatcagcgttttcccctctttacc
tttcgagtcttatcagattggtttgataacaagacagatctatacagatggaaaatggtt
gatcattacatcagccgtgtccgtggaaatctccaaatgttagaacagctagacctgatt
ggaaaaaccagtgaaatggctagactttttggcattcagtttttacatgtactcacaagg
ggttcacagtaccgtgtggaatcaatgatgttgcgtattgctaaaccaatgaactatatt
cctgtgacacctagtgtacagcagaggtcccaaatgagagcgccacagtgtgtcccccta
attatggagcctgagtctcgcttctatagcaactctgttcttgttttggatttccagtca
ctatatccttctattgtgattgcatacaactactgtttttccacctgccttggccatgtg
gagaccttgggaaagtacgatgaattcaaatttggctgtacctctctaagagtgcctcca
gatttactttaccaaattaggcatgatatcacagtgtcccccaatggaatagcttttgtc
aagccttcagtaagaaagggtgtgctaccaagaatgctggaagaaattttgaagactaga
ctcatggtgaagcagtcaatgaaggcttacaagcaagacagagccctttcacgaatgctc
gatgcacgtcagctaggacttaagcttatagcaaatgtcacatttggctatacagctgct
aatttttctggcagaatgccatgcattgaggttggtgatagtattgttcacaaggccaga
gagaccttggaacgagctattaaactggtgaatgataccaagaaatggggagctagggtt
gtatatggtgatactgacagtatgtttgtgctactgaaaggagctactaaggagcagtct
tttaagattggtcaggaaattgctgaagctgtaactgctaccaatccaaaaccagtgaaa
ttgaagtttgaaaaggtatatttgccctgtgttttacaaacaaaaaaaaggtatgtgggt
tacatgtatgaaacactggatcaaaaggacccagtatttgacgcaaaaggaatagaaacg
gtcagaagagattcctgccctgctgttgctaagatacttgagcgttctctgaagctgcta
tttgaaacaagagatataagtttaattaaacagtatgttcagcgacaatgtatgaagctt
ctggaaggaaaggccagcatacaagactttgtctttgccaaggaatacagaggaagtttc
tcttataaacctggagcttgtgtgccagcccttgaacttacaaggaaaatgcttacttat
gaccggcgctccgagcctcgagttggggagcgagtgccctacgtgatcatttatggggcc
cccggagtaccacttatccagctggtaaggcgcccagtagaagtcctgcaggacccgact
ctgagattgaatgccacttactatatcaccaagcagatccttccacccctggcaagagtc
ttctcacttattggtattgatgtcttcagctggtatcacgaattaccaaggatccagaaa
gccaccagctcctctagaagtgaacctgaagggcggaagggcactatttcccagtatttc
actaccttgcactgtccagtgtgcgatgacctgactcaacacggcatctgtagtaggtgt
cggagccagccccagcatgtcgcagtcatcctcaaccaagaaattcgggagttggaacgc
aaacaggagcaacttgtgaagatttgcaaaaactgtaccggttgctttgatcgacacatc
ccatgcgtttctctgaactgcccagtacttttcaaactctcccgagtaaatagagaatta
tccaaggcaccatatcttcggcaattactagaccagttttaa

DBGET integrated database retrieval system