KEGG   Miniopterus natalensis: 107540684
Entry
107540684         CDS       T05883                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04360  Axon guidance
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04520  Adherens junction
mna04611  Platelet activation
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04725  Cholinergic synapse
mna05020  Prion disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107540684 (FYN)
   04071 Sphingolipid signaling pathway
    107540684 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107540684 (FYN)
   04520 Adherens junction
    107540684 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107540684 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    107540684 (FYN)
   04660 T cell receptor signaling pathway
    107540684 (FYN)
   04664 Fc epsilon RI signaling pathway
    107540684 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    107540684 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    107540684 (FYN)
   04380 Osteoclast differentiation
    107540684 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107540684 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107540684 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107540684 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107540684 (FYN)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107540684 (FYN)
Protein kinases [BR:mna01001]
 Non-receptor tyrosine kinases
  SRC family
   107540684 (FYN)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107540684 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    107540684 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 107540684
NCBI-ProteinID: XP_016072978
LinkDB
Position
Unknown
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacagaggagagggatggc
agcctgaaccagagctccgggtaccgctatggcacagaccccactcctcagcactacccc
agcttcggcgtgacctccatcccgaactacaacaacttccacgcagccggaggccaagga
ctcaccgtctttgggggcgtgaactcttcgtctcatactgggaccttgcgtacgagagga
gggacaggagtgaccctgtttgtggccctttacgattatgaagcacggacggaagatgac
ctgagttttcacaaaggagagaaatttcagatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaaccggagagacaggttacattcccagcaattacgtggctccg
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagcttttgtcctttggaaaccctcgaggtacctttcttatccgtgagagtgaaacc
accaaaggtgcctattcactttccatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggcggatactatataaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagaca
cttaaaccaggcacaatgtccccggaatcgttcctcgaggaagcacagatcatgaagaag
ctgaagcatgacaagctggtccagttgtacgcagtggtgtccgaggagcccatctacatt
gtcaccgagtacatgaataaaggaagtttacttgatttcttaaaagacggagaaggaaga
gctctgaaattaccgaatctggtggacatggcagcacaggttgctgcaggaatggcttac
atcgagcgcatgaattacatccacagagatctgcggtcggcaaacatcctagtggggaat
gggctaatatgcaagattgctgactttggattggccagattgatcgaagacaatgagtac
acagccagacaaggtgcaaagttccccattaagtggacagcccccgaagcagccctgtat
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcctactcacagagctggtc
accaaaggaagagtgccctacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgcggctacaggatgccctgcccgcaggactgccccatctccctgcacgagctcatgatc
cactgctggaaaaaggaccccgaagaacggcccactttcgaatacttacagggcttcctg
gaagactacttcacagcaacagaaccccagtatcagcctggcgaaaacctgtaa

DBGET integrated database retrieval system